CAZyme Information: FVEG_00761-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_00761-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		41847.44	5.9124

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000578.1:3978238-3979419(-)

Full Sequence      

MIANKLTILTATAALLEPALALGHRHAHHQHAQKRGDWVVATIDGQVVSWENNYFGPGGS
APAATQPAAASQPEAYSAPAPAPAPAAAQPTTIIKVAKPSQAAKSAYEPASQPKKQETAA
KAPQKAAIKEKTQSKAKSSSTQSKSSGSSSGGSAGFSHKRGVCYNNVELANTFAGDCKNC
GWGYNWDSSSDGLTKGLNFIPTLWNDQPLHTDRFADNCAQALSDGAKAIFSFNEPDNAGQ
ADMTPAYAATAHVKWLNPYAGKALIGAPSISNSGLPGEGVEWLKSWVSECEKLDEQCHYD
FCNVHWYSEVEYGSTLFDHLKASHEACGGKPIWLTEFAPTGSDEAIASWLKDAIPQLEDL
SYLDAYSYFKVETGMLMTSETELSSYGSVYASA

Enzyme Prediction     

No EC number prediction in FVEG_00761-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	176	390	2.3e-55	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.06e-49	163	390	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT62615.1|GH128	4.38e-237	1	393	1	390
QGI76302.1|GH128	3.41e-235	1	393	120	509
QGI59088.1|GH128	3.41e-235	1	393	120	509
QGI89998.1|GH128	3.41e-235	1	393	120	509
QKD47197.1|GH128	2.14e-232	1	393	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	2.88e-39	157	390	2	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	6.55e-39	157	390	33	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB2_A	5.28e-17	225	377	97	238	Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_C Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_D Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB3_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB3_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB4_A Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB4_B Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB5_A Crystal structure (P21 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB6_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritetraose [Lentinula edodes]
6UAX_A	3.76e-15	182	393	117	345	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	1.19e-14	182	393	47	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	8.61e-17	157	392	294	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000302	0.999680	CS pos: 21-22. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in FVEG_00761-t26_1-p1.