CAZyme Information: FVEG_00262-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_00262-t26_1-p1
• CAZy Family: AA12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		69891.18	4.5049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000578.1:5521344-5523516(-)

Full Sequence      

MFLNHLKLAFGAVLATGSGTLATKPDVYDYVIIGSGPGGGSLAANLAREGHSVFLIEAGG
DNHTSILQQLPALSRTAAETPGHSWQFFVNHYEDFDAARRDPKYTYIQTNGSYYVGLDPP
EGARPAGLYYPRGSTLGGSAQVNAMNFAWCPDNEWDYIANLTGDASWGHEHMRRHLMNLE
NCTYVPEGTPGHGFDGYLVNDQSNATVNIGSPNVANFFSQMFHETEGFDVEDPAEMTELL
LRDINGPDPRRYENGRMYSTPVAIDPSTAARSGAGIYINQVIDAGHPLTISFHSLATRVL
TKQGRNKKPRAYGVEYMVGEGLYSADGRYDPEQTGEIREVHAKHEVIVSGGAFNTPQILM
LSGIGPREELEAWDIPVVVDLPAVGSNLHDNYEVPVQMRGEENWLIPQESPCTGTFDDED
PCFVLWRDDASGPYASRDSSYGAVWRSSQSWDNDSDLMFLSSPGLSGLVGFYPGYSTGER
AGNDPAGWMHAVVKMQTSNSAGTVRLNSSDPRIRPNINFNYFTESAERDLDAIVEGIEML
KRAFDATGVPYTQLSPDPENLRQSIQDLAFSHHASSTCAIGADDDEDSCVDSRFRVRGVD
NLRVVDASVFPRSPGGMPNGPTWTISRKAFETLLEDNH

Enzyme Prediction     

No EC number prediction in FVEG_00262-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	28	635	4.4e-92	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.89e-53	28	629	6	527	choline dehydrogenase; Validated
225186	BetA	5.69e-51	28	637	8	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.61e-31	499	629	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.08e-21	284	618	229	561	Protein HOTHEAD
366272	GMC_oxred_N	4.85e-14	128	393	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI76742.1|AA3	0.0	1	638	1	638
QGI90450.1|AA3	0.0	1	638	1	638
QGI59540.1|AA3	0.0	1	638	1	638
QKD46715.1|AA3	0.0	1	638	1	638
CCT63073.1|AA3	0.0	1	638	1	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	5.36e-34	6	629	20	593	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	4.11e-28	28	636	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	5.46e-28	28	636	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
7AV4_AAA	1.99e-26	13	633	71	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	6.54e-26	13	633	11	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q88AE7|BETA_PSESM	4.39e-41	23	633	2	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=betA PE=3 SV=1
sp|Q48CM7|BETA_PSE14	2.06e-40	23	633	2	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	3.45e-40	28	634	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q4ZM63|BETA_PSEU2	5.20e-40	23	633	2	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	6.39e-40	28	634	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.584190	0.415827

TMHMM  Annotations     

There is no transmembrane helices in FVEG_00262-t26_1-p1.