CAZyme Information: FVEG_00179-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_00179-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	CM000578.1|CGC9	42551.50	5.5373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000578.1:5746584-5747702(-)

Full Sequence      

MPSHVHDIASQDVHKQIQQLIHELVNIKDTTGEFLMTLADGRIIDTKGWNDWEWTHGIGL
YGIWKYYEMTGEDQWLKIIEDWFQARFAEGHKGKNINTMAVFLTLAYVYEKTQNPTYLPW
LDAWAEWAMHDLPRTKYGGFQHITYLDINEQQLWDDTLMMTVMPLAKIGLVLNRPEYVAE
AKKQFLLHIQYLFDTKTGLFFHGWTFKDGGHNFADARWARGNSWVTIVIPEFLELVGIKE
DDPIGSHLINTLDSQCAALAKTQRANGLWSTLLDVPESEGSYVEASATAGFAYGILKAER
KRYIGKEYSEVAVKAIKAVLENISPEGELLNTSFGTGMGHDLQHYKDIPRTSMPYGQAMA
MMALVEFLRAYN

Enzyme Prediction     

No EC number prediction in FVEG_00179-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	369	4.5e-110	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	8.96e-116	18	371	2	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	8.48e-107	26	371	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI90529.1|GH105	1.30e-283	1	372	1	372
CCT63153.1|GH105	1.30e-283	1	372	1	372
QGI76819.1|GH105	1.30e-283	1	372	1	372
QKD46631.1|GH105	1.84e-283	1	372	1	372
QPC65855.1|GH105	3.23e-268	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	5.25e-190	9	371	4	372	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	3.34e-169	6	371	19	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.08e-160	8	371	22	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	1.82e-15	52	320	23	299	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.59e-44	52	369	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.90e-09	154	368	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.20e-08	169	320	10	163	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.20e-08	169	320	10	163	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_00179-t26_1-p1.