CAZyme Information: FVEG_00084-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_00084-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	CM000578.1|CGC27	92570.30	8.3038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000578.1:6002070-6004809(+)

Full Sequence      

MSMSYRAPLFSQVPTYAEDPEHGTELHPFARYRPASSLLGHDPDAQVHVPIPSDLADAAL
DPNSMTGWDFFEMALLTYTAISTDPQEFYEKHDLRPKRFQHPRHTEILVGITVYNEPKHL
LRRTLLSVVQNIWYLNIRTQSKVWGKKSWTKIVVCILIDGLESADPDVLDVLTTIGLYQN
GLCKKTTEKGEEVTGHLFEFSSHLATHLGCEDYPDGEVDAPKLVNNHLIRNSERSMRFPV
QLMLLMKASNCGKLNSYRWLYNGFAKVLEPNITVHLDVGTKLGKQALFKLWKEFDLEPRL
AAACGEISCSLGGNWLNILNPIVAAQNFEYKVGFQLDRTFESATGFLSLLPGACSAYRYV
GSAGKPLEDMLLGDPTWIQGHNERLSLSPVNLLSPVNLNRHLADDRVMCFRIISKPNTHW
LLKYVPVTATTDIPMTTTDFINQRRRWLNGAFFSTIYVLKRLFWLLSWLGSHSRLFYSRH
SRSTASLETLRKDAPAGGIPFGKATPIVNAVIQIVYLATVLFQFILALGSRPRNHRISYI
ISFAIFGLIQAYLIMNLIYLVKRVADYKADDTWSSNYAYIGEFYADIGQSTIIVAGFSVF
GVYILSALLALDPWHLLTSFAQFLFISSSYVNILNIYAFSNTHDVSWGRKGRHQDTEEGQ
RQEGPRPATIERRFTFSDQDPNIRSAATQRDETPQARNREYQEALARATAENETVSHERK
RPQVLAVADAMMEFRTILLASYIFSNIFVCLIVMNDSIKILWWLGDSYWYKVWFFRIWLW
ANSISFLIRFAGCLWYHVVRVFSGFFRGTLT

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	113	294	3.2e-51	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.51e-62	114	294	2	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	4.60e-49	109	453	1	243	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.44e-13	262	565	130	388	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	5.48e-09	276	462	208	381	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	2.28e-07	266	358	75	162	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT63250.1|GT2	0.0	1	809	1	798
UPK95347.1|GT2	3.34e-223	37	800	47	806
BCR98831.1|GT2	1.49e-147	76	796	1	714
CAK96843.1|GT2	4.40e-147	47	796	158	901
BCS11147.1|GT2	1.76e-146	47	796	159	902

PDB Hits     

FVEG_00084-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54267|CHSG_ASPFU	1.10e-146	47	796	155	898	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|Q00757|CHSB_EMENI	3.10e-143	47	796	160	903	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P30602|CHS3_EXODE	3.05e-137	47	758	148	857	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P29070|CHS1_NEUCR	1.85e-131	50	796	161	904	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|Q92197|CHSC_ASPFU	2.02e-131	47	796	137	880	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999946	0.000113

TMHMM  Annotations     

Start	End
447	469
507	529
539	561
587	609
619	641
742	764
777	799