CAZyme Information: FUN_024615-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_024615-T1-p1
• CAZy Family: GT49
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase [Source:UniProtKB/TrEMBL;Acc:A0A2N1NSS4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	CP080894|CGC7	62563.15	8.3578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080894:4342337-4344311(-)

Full Sequence      

MIKKNFIVLLSILFLFLNQIYATYDYVPRSADIDRSPKNILVGSFIGGRSHLKPMLDITT
ILSERGYNVILLTKGNYTPSSEYPTVKQISLGPALNYKELMKSHIHKDVDFNGMMKFVKL
SLESYRENYEKYINIAKDNNIDLFFCDTLVNDVCLDAAHTLKKPVIGFSSSIYFTAPVSY
KSDPLYGCNISLENEPFLKRFKCIAMHPFQVYFAAHSFIDKLNDIRKKINVEPGLIALGN
SPRIPFYLVDGFFGFDLPQSLPSNVQEIGPVLSDDYPPLTPELSYFMNTHKRVLYVAFGT
HFFTTTENNNKLLQSFIEAINKNIIDGVVWALVETSKDSYSSTLNLTDGTQVQTSPILNN
EHPHIHIAAFAPQFSILNHTNTKLFFSHGGAGSSHESLYTGTPMLILPFGSDQMGNADKL
KSAGVALTLYKFTLDVNDIINKIDFLLRDENVKKNSKRIEILSKINSKRKYRAADLIEYI
LHSSSIYEGIDKEFLKEWIPAESRMGFIKKYNYDVYGALLSIILGFIGGILWITFKLIGF
IIASSNQKQKYE

Enzyme Prediction     

No EC number prediction in FUN_024615-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	144	459	6.9e-27	0.693717277486911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	6.54e-43	39	480	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.05e-25	40	478	4	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	1.56e-17	62	458	45	441	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	4.09e-17	50	536	11	483	UDP-glucoronosyl and UDP-glucosyl transferase.
177813	PLN02152	2.39e-07	289	421	259	385	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56593.1|GT1	1.89e-58	37	516	7	500
QGI59140.1|GT1	1.20e-57	31	521	2	507
QGI90050.1|GT1	1.20e-57	31	521	2	507
CCT62669.1|GT1	1.20e-57	31	521	2	507
QKD47039.1|GT1	1.67e-57	38	516	9	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CJX_A	6.79e-11	372	456	78	166	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	8.09e-11	299	455	19	182	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
2O6L_A	7.24e-09	372	455	77	160	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2IYF_A	7.88e-09	364	478	284	395	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
4M83_A	7.88e-09	364	478	284	395	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6ZQM8|UD17_MOUSE	2.59e-16	128	536	130	506	UDP-glucuronosyltransferase 1A7 OS=Mus musculus OX=10090 GN=Ugt1a7 PE=1 SV=1
sp|Q9HAW8|UD110_HUMAN	1.41e-15	128	536	129	505	UDP-glucuronosyltransferase 1A10 OS=Homo sapiens OX=9606 GN=UGT1A10 PE=1 SV=1
sp|O60656|UD19_HUMAN	3.30e-15	130	536	131	505	UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
sp|Q9HAW9|UD18_HUMAN	4.38e-15	128	536	129	505	UDP-glucuronosyltransferase 1A8 OS=Homo sapiens OX=9606 GN=UGT1A8 PE=1 SV=1
sp|Q28612|UD14_RABIT	4.41e-15	193	540	202	511	UDP-glucuronosyltransferase 1A4 OS=Oryctolagus cuniculus OX=9986 GN=Ugt1a4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999633	CS pos: 22-23. Pr: 0.9750

TMHMM  Annotations     

Start	End
5	27
513	535