CAZyme Information: FUN_023933-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_023933-T1-p1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		49352.91	6.8994

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080894:840204-841822(-)

Full Sequence      

MRAEGTKAIKFLFLVYIAFSVLYTLNYFYVVYSNTYASNNNIKPRNSLGLDFQTSEWGND
KLSWGTSDYMTEEFFLSKVFSESMQPSHVIPYYFRAVKTPKEEDITITTLITENRFHVFD
RLVTNYQGPISVTIHVADDEKSRDVLLSKLHDLYNGNEYMKQYVDVHLVVDNFERQFNMW
RNVAKFFARTNYVMMLDVDFHPCTDFRHAILNNEEIMKKLRTGNTALVVPAFEYADLQEG
LDFHTFPTKKADALELVESGRLVMFHASWKPGHGPSNYTHWYGTNELYKVTTYQYQYEPY
VIFPKQSIWCDERFVGYGANKAACLFELYLSGVDYWVLPNDFLIHQTHEYLEDARRHERR
FNKKLYDHFREELCFRYARNFILNDEWKTEKADNLKNTCNKIRGFSQAIKYFSSMK

Enzyme Prediction     

No EC number prediction in FUN_023933-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	97	378	8.2e-44	0.8367952522255193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.31e-59	104	377	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06217.1|GT49	1.09e-157	6	409	10	431
CDS06289.1|GT49	1.92e-153	6	409	8	421
CDS09884.1|GT49	7.11e-153	56	409	40	390
CDS10115.1|GT49	1.14e-148	1	409	1	426
CDS14203.1|GT49	1.22e-147	7	409	9	424

PDB Hits     

FUN_023933-T1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66PG1|LARG2_DANRE	5.11e-28	92	348	453	702	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|Q66PG4|LARG2_CHICK	6.78e-28	88	348	440	691	Xylosyl- and glucuronyltransferase LARGE2s OS=Gallus gallus OX=9031 GN=LARGE2 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	2.28e-27	46	348	426	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|O95461|LARG1_HUMAN	3.06e-27	46	348	426	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q5XPT3|LARG2_MOUSE	5.05e-27	100	378	398	673	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999993	0.000000

TMHMM  Annotations     

Start	End
12	31