CAZyme Information: FUN_023312-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_023312-T1-p1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		50762.07	7.7400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080893:2532976-2534678(+)

Full Sequence      

MSLKTIIAQISLKVDYVTIEGLEYFKSHNFSSNNPNPALKSINSTASIALKNDSPYSVMN
TTVTPPNGNKREYISYAPYLWPSCKGIKNVTDPETQCPYKPRDGLYNPDVRNLSDPVDSR
NMVRDVLSLSIFYQLHGDENFAEKAVQLLDTWFVNEETSMLPEVIYGQIKRGPGEWKGRE
EGILDTRLYVYIPVAVRILEKSRAWNDNIDKGIRNWISDFSNWLMNSNLGKQAFKRSNNH
ATFYVAQLATYLEFSGRIDEARNLIRKFSETTFQNMILKSGEQPMESKRTKPYHYQCFNL
EALTYIALLSQKINGTNLWEIRTKDGATIQNAVDYLIPLKNQDAGQEGEAILLPALYKAR
DYYGDRSGKYANTISKFLKTTNGASEWWTIYSPKSLRDGNVKNSNGKSYNYDNYDSYSEN
SATSLFGTSLYAMLSFDTEIIGRTE

Enzyme Prediction     

No EC number prediction in FUN_023312-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	58	342	2e-83	0.982078853046595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.63e-57	57	338	1	266	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW19896.1|PL38	3.98e-71	50	380	59	391
QRW24462.1|PL38	3.28e-67	23	375	33	392
QRW05956.1|PL38	3.84e-64	53	375	62	391
QRW12314.1|PL38	3.84e-64	53	375	62	391
QRV83646.1|PL38	5.39e-64	53	375	62	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.08e-39	37	338	28	319	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

FUN_023312-T1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000012

TMHMM  Annotations     

There is no transmembrane helices in FUN_023312-T1-p1.