CAZyme Information: FUN_022248-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_022248-T1-p1
• CAZy Family: GT33
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
691		78974.18	9.2534

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080892:1416240-1418415(+)

Full Sequence      

MKPLKARTRSVSPSIRVPSEHNPLKSSFANRSSFFKRTVNKISSLFEKRRYKPIIFFILL
IFCLALFHTILSPIFPGGEYHQLLIEKQKYDSIPYIGLDQNIPAELIEGTTIYHVSKEFG
PATLSNVGQVVTSLASSQANNGSLDVNVIIPYYSFIKRLYRLQKFAQLEVQIRDSHQKWK
PVKFFVHRFLWNITSNPDDPNGKITNLSEPRSVQVYLIGSPKGVFPLDLSFIADDATEIY
SSRYPLSQDWQDIFFCKAAAELITYLNTDIDTPLFDLKETRGVDVVHLHGSPNALVIEFM
KSLYVGGKFKMAPPSIVYTIHDHLKEHLYSNSIVNVQKFIELKNYPKVRSQYFNGRQLYT
SAIGIDQAQMVTFTSKIIAQEMVEDSMDFYAKELIIPSILKRAIKGEWIGISNGLDFNLY
NPFNDILLVETNSNFPKNIHNFDPALLYAESIENSTQSLITTSKFNAKLHLVREGLLLKE
DLNRTIVLFIGNFQYTKGLEFFQAAIDLLVSKNIKFIIMEDSGFPISSLKHLVNYYPNNL
VIIDDVDFKLSWGNLYRTAADILFVPSKTESFGLMAAAEGLLFGSPIVSIGSEKLKEYLV
NKTNMNNYNSYLYNLKDENNSELSINEMKIALNNSVDDMIRLNNNPIEKEIFIRKIIKDA
LKLGWNRPGGPIEEYIKVYRTALLKLRKKLN

Enzyme Prediction     

No EC number prediction in FUN_022248-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	112	680	1.9e-40	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223374	GlgA	1.68e-19	112	589	3	398	Glycogen synthase [Carbohydrate transport and metabolism].
340822	GT5_Glycogen_synthase_DULL1-like	2.72e-19	112	589	2	398	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
400563	Glyco_transf_5	3.40e-14	112	321	1	166	Starch synthase catalytic domain.
234809	glgA	1.83e-11	128	589	20	386	glycogen synthase GlgA.
172588	PRK14098	2.45e-09	284	575	143	397	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06183.1|GT0	6.01e-106	85	683	127	802
CDS14426.1|GT0	5.96e-103	47	682	63	719
CDR38054.1|GT0	1.71e-96	83	691	111	813
APJ04654.1|GT5	6.11e-18	112	683	191	715
APD50464.1|GT5	9.21e-13	112	613	36	482

PDB Hits     

FUN_022248-T1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2JNM6|GLGA1_SYNJB	1.38e-09	254	679	114	485	Glycogen synthase 1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) OX=321332 GN=glgA1 PE=3 SV=1
sp|B5YG91|GLGA_THEYD	2.45e-09	235	689	108	493	Glycogen synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) OX=289376 GN=glgA PE=3 SV=1
sp|Q2JSZ9|GLGA1_SYNJA	2.96e-08	254	679	114	485	Glycogen synthase 1 OS=Synechococcus sp. (strain JA-3-3Ab) OX=321327 GN=glgA1 PE=3 SV=1
sp|B4SC83|GLGA_PELPB	3.60e-07	112	575	8	397	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
sp|Q604D9|GLGA2_METCA	1.09e-06	254	679	111	481	Glycogen synthase 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=glgA2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999973	0.000050

TMHMM  Annotations     

Start	End
53	75