CAZyme Information: FUN_019744-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_019744-T1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495		55475.54	7.4601

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080919:582779-584333(+)

Full Sequence      

MKLIKQLDIVLLLLWCILSFNFIENVNSSLISPILPPYHICLRSIEGPVIYPSDSRFQSL
IIDDNIRVNYTPSVLVYAVNNEDVKNAVKCAVKWKTDIVPRSGGHSYEKYSLGGRDNVIV
LDVTLINDITINSNSEPKTAKIGAGNRLGNIYVKLSEAGFLIPAGTCPSVGIGGHALVGG
IGYCSRTYGITCDNVISMEMVNAKGELLHIDSTSHPKLFFALRGAGGGSYGIVTSYVFHI
HPAPPQATYMRFAFNRTNLAQVHQLIFALNEVGPLIDNKIGLKLRLFKTSLIATVLYLGP
RTEAKNAMKDFLSKAPERISSEYNQLTFLEAIIAVADVSEYDMYHPSHHPIFFKLKSFYV
NQGEGLNQAAINDLVDFSNRASCEVLTTFDLYGGKINIDRHNTSFVHRNALYCIRMQMES
YEALSPQCIDEMDNFGRRFQYKINSTSSYQGFIDRSLDNWQSRYYGNIFGKLVEIKNEYD
PNNLFNFPQSIPISY

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	66	264	1.6e-77	0.42358078602620086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	2.25e-32	42	493	2	458	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.14e-31	72	211	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	6.28e-13	448	492	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	2.80e-09	72	244	134	308	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	3.01e-04	165	251	173	249	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW00715.1|AA7	1.07e-53	47	494	40	492
CCA69005.1|AA7	1.96e-52	41	493	29	486
QRC92907.1|AA7	3.00e-52	41	491	32	490
QRW15212.1|AA7	1.10e-51	47	494	40	492
QRV86657.1|AA7	1.10e-51	47	494	40	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO4_A	5.97e-74	41	495	17	472	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	3.25e-73	41	495	17	472	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
5K8E_A	5.73e-40	41	491	30	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6YJO_A	6.60e-39	12	491	6	501	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
3RJ8_A	6.07e-37	41	491	6	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O06997|YVDP_BACSU	2.99e-46	45	494	6	446	Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) OX=224308 GN=yvdP PE=1 SV=1
sp|Q796Y5|YGAK_BACSU	8.39e-44	45	492	6	443	Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaK PE=3 SV=4
sp|G2QG48|XYLO_MYCTT	2.95e-39	41	491	30	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|B6HNK6|SORD_PENRW	8.50e-37	42	492	12	468	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|I1SB12|MNCO_MICNN	4.26e-36	41	491	28	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999785	CS pos: 28-29. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in FUN_019744-T1-p1.