CAZyme Information: FUN_019280-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_019280-T1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		48636.37	8.7904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080918:1256204-1257436(-)

Full Sequence      

MWTFAPGVKDDHLHISNINDKFYANYLDTFRQQHYNMLSNLINKANKALKNDSVYSVTLK
PQLAPSNDPHDYMSLARYFWPDPNKPDGLPYMRKDGYSNPEIETIKDYSLLRKLFDDVEN
LGFAYYFTRNDSYVEKAVYRIKEWFINPKTRMNPNLNYASFIKGQDLGRRTGIIDMRPIY
RMLQSIPLMRSSRKWDHSVEKKFKIWLSKYYFWLEKTSIGIDEKEATNNHGTYYDVQAIY
LLSYLGREEEARKYSYEALINRVNEGILPTGQQPHETKRPTSWYYSTFNLQALFLLAERS
QYFGFDGWNYVGPEGQSIRKAVDYLLSFALSNGKGWPFKNINGFEMNNFVKLLELAFVIW
PDDKYLEALVILRPKAKLEQALEYKDTEWEDNYLCIWSLMTNRQLWTCLK

Enzyme Prediction     

No EC number prediction in FUN_019280-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	57	331	2.3e-99	0.982078853046595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	6.83e-69	56	336	1	274	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13453.1|PL38	1.17e-79	8	366	22	383
AYQ31188.1|PL38	1.30e-78	41	377	66	400
CCH01052.1|PL38	2.63e-77	41	356	62	375
SOE20097.1|PL38	6.95e-77	37	367	64	392
QIP15531.1|PL38	1.18e-75	41	356	58	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.50e-55	41	345	33	337	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

FUN_019280-T1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000005

TMHMM  Annotations     

There is no transmembrane helices in FUN_019280-T1-p1.