CAZyme Information: FUN_018752-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_018752-T1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	CP080917|CGC2	88546.67	6.6414

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080917:1604004-1607225(-)

Full Sequence      

MVSSAVTSHITNNVSNGTTKHTRIINVTHMIPYTPVLESVEEKPSISYNWSLKQRRGHST
LYSGLKSLNSKWENHYVGYVGTILDKEEKPVEYSSISEELKQSLKEHLLKESISPLFLED
TEHHGHYDGYCKHVLWPLFHYILWDTVTDGRKEKTYWEQYVKVNQIFTDTIVNIYKPGDL
VWIHDYHLLLVPQMLRERLPDAAIGLFIHAPFPSSEIFRCLPKRKEILNGMLGANQIGFQ
TYSYSRHFISNCTRILGYETTPNGVDFEGSLVSIGTFPIGIDVERVEAQRKHSDVAPKMA
TIREMYADKKIIVGRDKLDSVKGVIQKLHSFEKFLEEYPEWRGNVVLIQVTSPAQIESQK
LEKKLSELISHINGTYGSLEFTPVHHYHNHIDQDEYFALLSVADIGLITSIRDGMNTTSL
EYIMCQQENHGPLILSEFTGMAGSLGAAIMVNPWDYSGVAKAINDALNLPAEEKKFKHMQ
LYKQVTNHTAQSWADSFVKELIVSLNNKDQSNVTPYLDFKYLQKKYKAAKKRLLLFDYDG
TLTPIVKIPSAAVPPSNLLEALGALTSDPDNSVWIVSGRDLTALETWLGSVKGLGFSAEH
GSFLKNPDSDKWINLTEDVDMSWKNDVTEIFTYYTERTQGSFIEHKRSSITWHYRQADPE
YGAFQAKECQNHLQSAILPKLPVEVLLGKKNLEVRPTSFNKGEIVKRLLISHPDADFVFC
AGDDRTDEDMFRALRRSELSSDTYFCTTIGASNKKTMAGWHVNSPEELIRFMQKLNE

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	19	501	2.5e-172	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395781	Glyco_transf_20	0.0	23	501	2	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	0.0	50	742	115	817	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	0.0	50	775	32	783	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	0.0	22	501	15	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
184712	PRK14501	0.0	61	775	30	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13004.1|GT20	0.0	23	769	25	769
CDS06611.1|GT20	0.0	49	769	144	865
AJH76892.1|GT20	0.0	23	772	25	826
CDS09548.1|GT20	2.36e-295	23	775	21	833
EGX46320.1|GT20	6.16e-291	50	769	61	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.02e-144	23	502	32	524	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	2.43e-121	23	501	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	2.77e-121	14	501	4	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.34e-120	23	501	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
6JBI_A	2.12e-118	23	501	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	3.51e-222	27	775	39	812	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	2.05e-201	16	769	8	840	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q54K57|TPSA_DICDI	2.29e-195	12	768	6	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9P4D3|TPS2_ZYGRO	5.04e-191	16	769	3	847	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	7.05e-186	54	776	72	788	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FUN_018752-T1-p1.