CAZyme Information: FUN_018296-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_018296-T1-p1
• CAZy Family: PL38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731		85304.33	6.8621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080916:2761879-2764074(+)

Full Sequence      

MATLKHDGSFEKTLIKNHFNCSPELFIRDDMKKTSLCIQQELETHHHKYPIGCSESYFES
KINELTHHNEIVTFGVLLPITSRELTKPEKCIENFSNLLKSLAETSQQDIQYRISGTRYQ
IKIYIGIDKDGHLFLNNSAEKIFYNHGFIDIDITKFDYFPGSTCDIWRELSRKAYKENCD
YIVLFENDIIIKTNGWMNKFHKTYLEISIQKKVPCNFGCVTFTDITFPGFPAFPVISRVH
LDTFNGDIIPQQKFQIQDVYTYLFQLYRRWGCSIILHDVEIQKIDVDQRYEKWYHSDWKF
DVLNNSVDRVEKWLNNNNKTPMQKLLTLDIVVPSYRVDFKYLDPIINLEIPVTMSTIIYI
IIDDQNSSNIILLKKLYEKDPFIRILVNKTNLGASLSRNRGLYESNADYILFLDDDVTPE
KDILFECEKVIKEHPTACGFIGSSKFPPANESIFKSAVVLSGVTFFWEIAEIWDNDIPWG
IAGNLLIRSYKDDILFDPSFPKTGGGEDIDFCLKKGNFFIKNVENGKGFQGAPNVKVTHH
WWNDGKRYYWRFYKWAKGDGALIKMHPNLTYNDIVPNSAEFLLGTTFILFITVIISSLIT
VFYDIEIINIFTILIFLSVPHVIISNFIFDIHLHLIIQPFKRVPTIRGYRYILAIFESSM
IRMTNEFGRLMGHIERKEWNYIGKRFDWFAKKNGGTMNDEISTNSRKFFIWVSLMVFSSS
VLLIVISESPM

Enzyme Prediction     

No EC number prediction in FUN_018296-T1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
132997	Glyco_tranf_GTA_type	3.61e-11	360	444	30	115	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
395426	Glycos_transf_2	1.30e-09	329	438	1	110	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133029	GT_2_like_c	3.19e-08	360	443	30	110	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
224137	GT2	4.07e-08	330	571	7	253	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
133016	Succinoglycan_BP_ExoA	3.79e-07	342	572	19	240	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV90438.1|GT2	5.71e-147	11	717	314	1015
QRV75675.1|GT2	2.75e-143	11	690	314	988
QRW04585.1|GT2	1.49e-133	11	690	315	992
QRW23776.1|GT2|GT8	1.54e-114	14	690	312	958
UFH56504.1|GT2	1.37e-32	327	583	25	273

PDB Hits     

FUN_018296-T1-p1 has no PDB hit.

Swiss-Prot Hits     

FUN_018296-T1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
581	603
610	632
708	727