CAZyme Information: FUN_016037-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_016037-T1-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1576		181029.40	5.3495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080914:2946365-2952841(+)

Full Sequence      

MVLKKLKYNTLLLVSYLFCIIFIVSKAETPPVQTWLKTSWDAPHLLLEIIESVSVENSTA
YYPLINEFINLGLFSSELTYHEMYNTALDVIESKQYLSTPTSISILEFSLSLHTTAPAIQ
AYYHYYNTTVVPSKHEPDINFNPECDVWVDWYGHQACNVEIFKELTGISKTGKFDKLLNS
SDQHPKLLSFDHILSSNAETTKPLIILYADVISPSFVPFHQFITDLVYNEEVEYVLRYKP
PRGSRNSLHLAGYGVELALKKTDYIVIDDREVETGDHNERENENSESYNDSHREKLSEHL
FDENISEIKPLTASAIRELGLKATQFIISSQNPLLTLTHLSQNLPKYSYHIAQLNLNSSL
KQEIKINQNYFGLDSNSFWLNGLTVDPSSVDPFSLLKLLRRERQNVLSLMSLNMTSQQAV
EFLASPIILESKSSQELTKGIFDVRDKSEKQNIIIWFNDIEKDKRYSNWPPRIFDILHPI
YPGHMKYIRKNLFNTLFVIDLSSVKSLEVINEIKLFIERNIPIRFGLIPLVVKEKNESII
MAKIFYYLIDQYTMPLIMQFSSQVLNELKNSPSANIVKIAEKQFNNVINDQTPKDNTSVK
SFDDIIKSDTESSLEEQILGATEFINKFRIDADGKGKGALFINGKYFDLDDNYQRDMIQT
ITEHTGFIQQKVYVGEISDHTNVFEYFMTLPRVPSRRNPHVFVSDSQPLNVINLVKNDEK
LSSGRYIYSTKQDGNEVPVSLLLITNFDSEYGAKQGLEALKYLDESSNARVAFIHNPSTQ
PSIREDISLSSLIYLILHSSETNTVDMPDLPKILKEAFEEYLNIENKIKMPFVEQTESQE
VPISNYESTNPARSFGWQFADKVKSQTYWKEWNSFTRKTLKLNENDTAIIVNGRVVGPFI
KEDLFVVDDFNLLVELEFSERIEPVINAAKAANLTIHLDRSNYPDFVTKATSIITASMTS
DVPVGLFGGQELKRDLSFKKLKSENSKIVVGDIEAAIYKISVLIDPLSETAQKWSTILEI
LSQIDGVAIELYFNPKMNLAEIPIKRFYRYVLEPKLKFNTTTGNLIAPSAHFSNLPEDPL
LTLGMDVIQAWLVTPKVSIHDLDNIRLANLDSRLRIKGVESVFELNNILIEGHARDMTLQ
APPSGLQIVLGTKNNPVMVDTIVMANLGYLQLKANPGIWTFSLREGRSSEIFDIQSAGSE
GWYSRNVEEIGNEIVLNNFEGLIIYPRFTRKPGKENEDVLKLEEKDGIWNYFMDKFSKNV
SKQNKAEINIFSVASGHLYERFLSIMILSVLKHTKSRVKFWFIENFLSPSFKDFIPHMAE
EYNFEYELVTYKWPHWLRAQKEKQRTIWGYKILFLDVLFPLDLDKVIFVDADQIVRADLK
ELVDMDLQGAPYGYTPFCDNRPEMDGFRFWKHGYWKDHLKGKPYHISALYVVDLQRFRHM
AAGDQIRGQYQSLSVDPNSLANLDQDLPNNIQHIVPIFSLPLEWLWCETWCSDESLAGAR
TIDLCNNPMTKEPKLDRARRQVPEWESYDKEIATFAAKISQSQKSFITESNIQSKSTIEV
SSESKIPVKTEKHEEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1268	1515	8.5e-135	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1268	1515	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1268	1535	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.35e-74	442	701	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	4.81e-64	1131	1240	1	108	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
132996	Glyco_transf_8	7.48e-61	1268	1515	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05797.1|GT24	0.0	32	1539	22	1443
QRD91624.1|GT24	0.0	29	1544	28	1464
QMW47293.1|GT24	0.0	29	1544	28	1464
QMW35231.1|GT24	0.0	29	1544	28	1464
BAE65008.1|GT24|2.4.1.-	0.0	29	1544	28	1464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	27	1541	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	27	1541	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	27	1541	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	5.37e-303	29	1477	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.64e-276	27	1541	6	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	2.91e-269	31	1551	21	1441	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	4.50e-260	6	1532	21	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	7.02e-260	26	1532	41	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	1.33e-258	8	1532	23	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	7.52e-251	26	1545	24	1517	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000530	0.999445	CS pos: 27-28. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in FUN_016037-T1-p1.