CAZyme Information: FUN_010930-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_010930-T1-p1
• CAZy Family: GH63
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647		73136.33	6.7403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080906:4237004-4239702(+)

Full Sequence      

MSSNLKLDKELKDDAEIRNLWLESIHIRDQQQIFKKTNEFYDFIIVGAGTAGCVLARELI
YNIPNINILVLEAGPPNTQVNDIMRSPCAFPSVHRTSETDWGYSTEDQKMSSIVDPTKEV
LNKGFPYARAKVIGGCSTVNGMIYIRGQKADYDFWATQGPEYKIWDYDHCLEAFKAVENN
ARKSPDEEFKKYHGFNGLLNVQDSSNDNYDILKDIYKIANNLGIPYNNDFNGVKQNGVGE
YQHTMKDGKRFSLADGYLTDALKKVETYPPSKPFEIGSPHGLSDDAAKFVAVNVKSFAHM
LNIIWDEEKKDENVAIGVKYFYDGRVHESFIAPKGEVIICGGAINSPQILMLSGIGPKSN
LEENNIKVRKELPVGRNLLEHPECCITAKVSVPNCTSASQLHYSSNGLELGMFYKSDING
KVPSQKHFLDERPNIQFYASTTQFGPAIIEPGKNEILTLISVLNLPSSVGHLELRSSNPF
IHPKIFLNFYEKPDDLYNMMSSLKLSREILKQPPLSTVWGVKEVGFDIDKEMSDEDWEQY
IRKMSFTSYHPCGTVKMAPESQGGCINHRLQVYGTKNLRVVDASIFPTIPAGNLNAPTAM
VAWKANLIVFREFYFTLKQKTTEFNKLNQTICIMLQIIHHKTYYNTK

Enzyme Prediction     

No EC number prediction in FUN_010930-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	28	605	8e-79	0.511326860841424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.15e-108	36	605	1	527	choline dehydrogenase; Validated
225186	BetA	2.44e-101	41	605	8	529	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	7.58e-57	42	609	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.15e-39	466	605	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.13e-31	128	383	22	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWC20507.1|AA3_2	9.42e-84	37	605	2	520
CAB3230510.1|AA3_2	3.04e-78	34	609	18	555
CAD7260190.1|AA3_2	3.24e-75	41	605	63	625
CAD7198751.1|AA3_2	4.51e-75	41	605	63	625
CAD7260194.1|AA3_2	3.22e-73	39	613	215	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.49e-53	41	613	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZH7_A	2.59e-53	41	605	8	556	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	2.59e-53	41	605	8	556	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	3.40e-53	41	605	24	572	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	3.57e-53	41	605	8	556	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WWW2|ALKJ_PSEPU	1.19e-76	41	612	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	3.70e-72	41	609	43	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	3.95e-72	41	605	46	572	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q47944|SDH_GLUOY	2.29e-71	41	605	5	523	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	3.23e-69	41	624	2	542	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FUN_010930-T1-p1.