CAZyme Information: FUN_010925-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_010925-T1-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		69597.14	7.3599

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080906:4215743-4218135(+)

Full Sequence      

MSLDLKTKLDKELKDDAEIRNLWLEGIHNRDHRQTFKKINEFYDFIIVGAGTAGCVLARE
LIYNIPNINILVLEAGPPNIQVNDIMRSPCAYPSVSRTIETDWGYYTENQKMPGIVDPTK
EVLNKGINYSRGKVIGGCSTVNAMIYTRGQKADYDLWAAQGPEYKIWDYDHCLEAYKAVE
NNTRKSPDEEFKKYHGFNGLLYVQDGQNDFDDIIKDVIKVTKNLGIPYNNDFNGVRQNGV
GRYQHTMKDGKRFSLADGYLTDALKKVETYPPSKPFDIGSPHGLSDNAAKFVAVNVKSFA
HMLNIIWDEEKKDENVAIGVKYFYDGRVHKSFIAPKGEVIICGGAFNSPQILMLSGIGPK
NNLEENNIKVRKELPVGRNLFDHPSCCITAKVSVPNSTSTSQLHYSSSGLELGMFYKGDI
KGKVPSQEHFLDERPDIQFHASTNLLDPVARANAKSGKKNDVLTLVSTLNLPSSVGHLEL
RSSNPFIHPKIFLNYYEKPDDLYLMMSSLKLSREIFKQPPLSTVWGVESDVDKEMSDEDW
EHYIRKKAFSSSHACGTVKMAPESKGGCVNHRLQVYGTKNLRVVDASIFPTIPAGNLNAP
TAMVAWKASILIEEDYKNKA

Enzyme Prediction     

No EC number prediction in FUN_010925-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	32	618	2.4e-81	0.5242718446601942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.98e-112	40	612	3	531	choline dehydrogenase; Validated
225186	BetA	3.44e-110	43	615	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.89e-58	44	609	2	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.90e-39	472	608	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.23e-33	131	384	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWC20507.1|AA3_2	8.89e-85	40	614	3	526
CAB3230510.1|AA3_2	4.76e-83	20	614	3	557
CAD7198751.1|AA3_2	2.03e-80	24	616	40	633
CAD7260190.1|AA3_2	3.97e-80	43	616	63	633
AWP09430.1|AA3_2	1.15e-75	43	612	20	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	1.20e-53	43	612	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.20e-53	43	612	8	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.58e-53	43	612	24	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	1.66e-53	43	612	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	2.11e-53	43	612	84	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	1.27e-78	43	613	46	577	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	6.32e-78	43	613	43	574	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	8.44e-78	43	612	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	2.69e-72	43	613	41	572	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q47944|SDH_GLUOY	7.30e-68	43	613	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FUN_010925-T1-p1.