CAZyme Information: FUN_008351-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_008351-T1-p1
• CAZy Family: GH15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1166		132910.81	9.5280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080904:3466078-3470288(-)

Full Sequence      

MDPKKSIPNPKRKRNNEELLINKKVKNSNVENVPSTSINSKNNVTSGIINKKATTKTRKI
PFNNIVNDTKRFTALPVPKKIIPRPSGKANVKASGKSVNYGRTVTKSCPIKPLKLVTKSM
TEKNRSRAGILESKQRLQLVTKSMTERSRSRAGILESKMQLAKSRREMIEIKKRNEAIRS
RISKIRDDLVRVENEHETLFKSIEQMKKQTATYNEEMKKLNEHCDVANEESNKLSEIILE
SRKGLELRNNKIIEKRLLYEYQLKQIQEIYAGLKAEENTRKDLHNQNLDLMGNIRVMCRV
RPYTDKEKEIEQVSLECFDDKHTIQVSTKRLRLWQMQIEKSTYEFDHVFNTSADQKEVYL
ELSPLVQSAIDGYNVCIFAYGQTGSGKTYTMEGNVNSPEKKGVIPRSIDEIFDKIEETNK
LGWNFEVYVQYIEIYNETIQDLLIDEDKDRKKSCKDRKKSFKEDRKKSFKESKDLCKIVY
NEDTRMTIIENAERLKISKKKDMEILIDKASNHRSKSSTNSNSVSSRSHGVFILHLEGEN
PLEKMSSRGSLSLVDLAGSENIDKSGSVGDQMTEAQSINKSLFYLRYVIQQIKDKSNHVN
YRDSVLTSLLKYSLGGTAKVCMLVNVSPSTDSTNETKKSLSFGQDARKAHVGTAMRNGPV
IFGNVKKYYFQKVISIMAKYEPLSTSESSSEPQIKRGSQLKALIIILFFVVFISVWNIIP
SYFYLEDTANNIDQTDQIPIEKTTLAIPTAVQTTSISSTLSPTSTSVTTPVKEPKPPMSE
SGKVIAAYFASWSIYARAYNVIDIDSDKVTHILYAFANIKPDGEVFLGDSWADTDKHFEG
DSWNDEKKNLYGNFKQLGLLKKKKKHFKVSLSIGGWSWSTNFPSVASKSDSRKKFVTSSI
ELLKDLGLDGLDIDWEYPQNEGDAKNYVKLLKELREALDEYSESQNHSHKLLLTAALPCG
EEQYKKMKLKDMNKYLDLFYLMAYDFSGSWSSKASHQSNLYGSDLSTHKAVDYYINKGVD
EDKIVIGMPMYGRAFQNTNGFGSSYNGVGEGTWEQGVYDYKKLPRQNATEHFDEKAIASY
SYSASDREFVTYDNPQVIIHKTDYVKHNNLRGVMFWELSGDFPTSHERSLLSAAYHGLGG
KDAIDQTPNHRSFPDSIYENVRNGFE

Enzyme Prediction     

EC	3.2.1.14:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	783	1126	4.3e-84	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
276817	KISc_C_terminal	1.74e-109	291	647	1	325	Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward.
119365	GH18_chitinase	5.51e-107	785	1121	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	2.31e-106	784	1121	1	334	Glyco_18 domain.
214526	KISc	4.34e-101	293	661	1	334	Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
276812	KISc	4.37e-93	293	647	1	326	Kinesin motor domain. Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14181.1|GH18	3.40e-136	776	1162	4	400
BAA13489.1|GH18|3.2.1.14	6.75e-133	775	1166	2	400
UJO23513.1|GH18	1.10e-124	787	1164	11	398
QPG94099.1|GH18	4.57e-123	778	1165	1	390
UOP57070.1|GH18	6.94e-123	783	1164	63	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D2K_A	3.26e-122	788	1164	8	389	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	8.89e-122	788	1164	8	389	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	1.74e-121	788	1164	8	389	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
1WNO_A	2.30e-116	779	1166	1	394	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]
6IGY_A	2.70e-116	787	1165	20	403	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1E3R8|CHI1_COCIM	1.00e-121	745	1164	9	424	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	1.40e-121	779	1164	34	424	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|C5P230|CHI1_COCP7	1.96e-121	745	1164	9	424	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|E9QRF2|CHIB1_ASPFU	1.51e-115	779	1166	39	432	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1
sp|Q873X9|CHIB1_ASPFM	1.51e-115	779	1166	39	432	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

Start	End
703	725