CAZyme Information: FUN_007910-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_007910-T1-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	CP080904|CGC2	63580.66	7.8504

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080904:719892-721957(-)

Full Sequence      

MYKRNFTFLLSLFLLNIIFHVNVITAKQDYVPTNFDLNHFPKNILVGSNTGGRSHLKPML
DIAAILSERGHNVILLTRGNYTPSSEYPTIKQISLGPTINIKDIKDLKQLVNKKFDFTAL
SKSLEFNVKLYESTFEKFKDAAIDNNIDLFICYAIINDACLDVAHTLKKPAVGLLSFLNL
MDSKPYKSDPIYHCNISLENESFMERFKCTVIQPLRMLSIMYPILNQLNDLRNQLGAEPV
FVSSKRLAQTSLIFIDTFFGFELPQSLPPNIQEIGPIMSNEYPPLTPELSDFINGHERVL
YVAFGGRFFTTVENNNKILQSLIEVINNNMVDGVIWALSQTSKDDFSPILNLNDGSQVQT
SSILSNKHPHIHITSFAPQFAVLNHTNTKLFFSHGGAGSTHESLFTGTPMLVLPIGGDQM
GNADKLKSIGIALSLDKFALEVNDIINKMNILLNDEDVKKNVERMKYLAKINSKRKYRAA
DLIEYVLLRNDLNKGSDQELKEFIPADTRMGFIRGNNYDVYVTILFIILGIIGLILRITF
KLITFIIWIIFPYSDQKSKRD

Enzyme Prediction     

No EC number prediction in FUN_007910-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	244	470	2.9e-27	0.5026178010471204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.07e-47	43	485	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
223071	egt	7.32e-20	252	468	248	445	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	8.57e-20	247	487	223	441	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	1.27e-19	51	491	10	403	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178032	PLN02410	2.83e-10	52	441	17	401	UDP-glucoronosyl/UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47039.1|GT1	1.85e-64	38	521	5	502
QGI59140.1|GT1	3.68e-63	36	521	3	502
QGI90050.1|GT1	3.68e-63	36	521	3	502
CCT62669.1|GT1	3.68e-63	36	521	3	502
QPC75432.1|GT1	5.33e-62	38	521	6	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	2.52e-13	275	465	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	3.21e-12	284	462	7	162	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	4.76e-12	279	465	1	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
4M83_A	1.12e-09	360	484	274	395	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]
2IYF_A	1.12e-09	360	484	274	395	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9TSL6|UDB23_MACFA	2.76e-17	244	561	247	529	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1
sp|P06133|UD2B4_HUMAN	6.45e-17	244	465	247	445	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q9GLD9|UDB33_MACMU	2.67e-16	244	561	247	529	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|O75795|UDB17_HUMAN	1.11e-15	54	465	34	446	UDP-glucuronosyltransferase 2B17 OS=Homo sapiens OX=9606 GN=UGT2B17 PE=1 SV=1
sp|P36513|UDB14_RABIT	1.11e-15	244	462	248	443	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005836	0.994122	CS pos: 26-27. Pr: 0.9479

TMHMM  Annotations     

Start	End
7	26
520	551