CAZyme Information: FUN_004847-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_004847-T1-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884		101836.25	6.8949

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080900:2684652-2687949(-)

Full Sequence      

MSSSFAKIIIDPLPGTDEYESGLKIFLRICRYLNPYNLLKLSCVCKKFNALLCSERYSIS
CLWEQSRIDFTPFGSMKCPEDMSNREFTKLLCIENGCQNCWNKNVRICIYWIPRVRLCES
CLLLLVISKKELEQKWIVAPELINVIPPVFHEDPWNEGNPWDESKKSYWISHVYEIQSEY
CTLKSNDEKSFLLSERKYIWSYWSSIDLYHKVAISNLIVQQEPNFQCNVSICEIMTLLNF
SNRPSKYYLLLTIILFHLIVIGINASSSDKINQADSSKTQSTASRNPTETASLWSIFKNI
FTKKQPDPNKFGKFEIDKNINETKNILVGSFVGGLSHLRPSLEICKILIERGYKVALVAP
GNFTSPTNYPSIRQYSTGPEHNTKELLHIYKEIYEKPYDYNSFFLEKDEADKQYSERFEV
YKRSTIDFKPDLFLCDLLNNEACFDIAWKFKIPAVGVSSSLSRRTFAPYKSDPIYGCHSN
MEKGSFIERFKCLIIQPARFLYESRQRIIFLNEKRLSVGVSPITSSLERIKNSLFLADTY
FGFEIPHPVPPLYQEIGPVMQESYPPLTPKLSSFLSLHQRIMYVSFGMQAFTTLENYAIL
LKSFLEVIDRNIIDGIVWSLSGLENFPTLSDDTQLETSEILNNRYTHIYVTTSSSLEELT
PQVSILNHSNTKIFLTHGGVASCHESLYVGKPMLILPLASDQFSNAEKLEEQGVALKLDK
MDLHVDDIVRKIEFLQLESRVKINLKRMQILTKINSKRKYRAADLIEFVMKASQLNPNNN
DVKESVVDNRHMKEGKESSEKVSNETNSESIEPAIEDIYEWLLKEWITPDSRMGFIRGKY
LDVYGVVLILLFSIIGSIIWTGWSVVSFIVNSIASLFEGKLKSD

Enzyme Prediction     

No EC number prediction in FUN_004847-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	541	736	2.7e-21	0.42408376963350786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.98e-33	325	767	2	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
223071	egt	5.43e-17	524	733	236	427	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	2.18e-15	486	771	181	442	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	2.44e-14	326	767	4	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178589	PLN03015	3.23e-09	551	760	237	449	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	2.14e-46	314	767	28	481
QGI59140.1|GT1	9.76e-41	324	770	9	466
QGI90050.1|GT1	9.76e-41	324	770	9	466
CCT62669.1|GT1	9.76e-41	324	770	9	466
QPC66669.1|GT1	2.43e-40	324	775	10	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	1.20e-09	557	733	19	171	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.86e-09	653	733	70	150	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	4.87e-07	653	719	69	135	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6J31_A	1.71e-06	661	719	288	344	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.72e-06	661	719	291	347	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06133|UD2B4_HUMAN	4.78e-12	522	733	243	430	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q5RFJ3|UD2A3_PONAB	6.29e-12	531	771	250	467	UDP-glucuronosyltransferase 2A3 OS=Pongo abelii OX=9601 GN=UGT2A3 PE=2 SV=1
sp|Q98166|UDPE_GVLO	6.78e-12	570	750	271	429	Ecdysteroid UDP-glucosyltransferase OS=Lacanobia oleracea granulosis virus OX=52412 GN=EGT PE=3 SV=1
sp|Q6UWM9|UD2A3_HUMAN	8.31e-12	531	771	250	467	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|P36514|UD2C1_RABIT	1.36e-11	401	719	101	389	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000000

TMHMM  Annotations     

Start	End
843	865