CAZyme Information: FUN_002943-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_002943-T1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	CP080898|CGC2	56199.61	6.0695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080898:567747-569358(+)

Full Sequence      

MEQVDKRMLMREELFGITDNLIPCMKQDTTEIFYRFLANKSKKIDMSILHSYTAEKMEFN
DIIEIDIQHSDDLHHYLLENAKSLQEECTTFDHLVIIDTFTMINLEKIKNKISTSTLVTD
TQKLVWGSFNSNRTENMAVIIGASAIQPILDNLKFKLNHTSILSSLYLYHKKYPNKKIPS
DLIFINDPISIIEWPNTITSIECADCVVAIGHIYQDVEIKQIKNELNIPTTLPCNARSDL
KMYSKETASKFRPNVAVVTSSFLYKDNCMLEAGFFSAKNKQEYAEMHGYAFVSRSAEFAQ
QLYHDRKPVWGKIDAIEKLLPYYEWLIWLDMDAIFVNRSLTVERFLEMCEEKVGGKEEFE
KINIIVARPINDKMINAGVFLIKNSAWTRDLLRRGIQPRYDFSYTGSLEQEAMRDAIRHP
YWRKNVLNLEYDDHSLNTFPDRYVRGDYIVHYAPIGGCPAAPVLRGLSNVKVLEEFPNAE
ISIPF

Enzyme Prediction     

No EC number prediction in FUN_002943-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	276	429	8e-20	0.6991869918699187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	6.95e-19	253	458	3	232	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.27e-09	252	392	126	262	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	1.18e-07	274	392	153	263	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05704.1|GT34	4.20e-79	2	475	153	685
CDS09137.1|GT34	2.79e-78	2	474	133	646
CAG4711197.1|GT34	1.06e-19	250	459	7	206
BBN05257.1|GT34	1.41e-15	279	453	140	330
ACO66271.1|GT34	2.27e-12	276	476	215	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	7.92e-06	276	392	59	169	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	7.03e-11	278	458	129	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.24e-09	278	458	129	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P50108|MNN10_YEAST	2.36e-09	276	440	149	333	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|Q9SZG1|GT6_ARATH	3.07e-06	278	456	133	308	Glycosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=GT6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FUN_002943-T1-p1.