CAZyme Information: FUN_002695-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_002695-T1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	CP080897|CGC1	63313.78	9.5999

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080897:4606532-4608541(-)

Full Sequence      

MNKKNFIFLLSLFLLNLIFRVNIIIATRNHIPTNFDINLSPKNILVGSYTGGRSHLKPML
DIAAILIERGHNVIMLSSGNYTPASEYPTIKQISMGPPLNIKNTRDSARLIVQAEFDYII
LAKIFESSVQSYKSTYEIYKDTAIDNNIDLFICYAMFNDACLDVAHALKKPVVGFMSFLY
VIDAQTYKSDPVFRCNISLENESFLERFKCTIIRPLHIISLLHTPLNQINDLRNQMSIEP
VYMSFRRLLRTSLVFIDTFFGLELPQALPSNVQEIGPIISKDYPPLTPELSNFMNVHERV
LYIAFGGRFFTTTENNNKILQSIIEIINKNMIDGVIWALVMTSKNDFSPTLNLSNGLQVQ
TSSILNNEHPHIHITNFAPQFAVLNHTNTKLFFSHGGAGSIHESLFTGTPMLVLPIGGDQ
MGNAQKLKSAGVALSLNKFTLDVNDIITKINFLLNDNDVKKNVDRMKVLAKINSKRKYRA
ADLIEYILHRGSSNQELKELIPADKRMGFIRGNNYDVYITLLGIVLGFIVVILRITFKLI
RIFVRIISPYSDQKPKRE

Enzyme Prediction     

No EC number prediction in FUN_002695-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	279	467	7.6e-25	0.39528795811518325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.07e-46	43	487	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.14e-20	44	485	4	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	2.26e-20	256	546	231	495	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	4.06e-19	269	498	264	475	ecdysteroid UDP-glucosyltransferase; Provisional
178032	PLN02410	1.69e-07	373	501	327	445	UDP-glucoronosyl/UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC75432.1|GT1	6.91e-53	42	527	10	513
QKD47039.1|GT1	9.39e-53	42	527	9	512
UPK98814.1|GT1	2.45e-52	42	518	9	502
CEI64654.1|GT1	2.54e-52	42	527	10	513
QGI59140.1|GT1	4.79e-52	42	527	9	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	9.73e-12	276	466	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.48e-11	379	463	78	162	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	1.17e-09	379	466	77	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6J31_A	5.70e-09	370	485	279	391	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	5.76e-09	370	485	282	394	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54855|UDB15_HUMAN	1.09e-15	54	534	34	511	UDP-glucuronosyltransferase 2B15 OS=Homo sapiens OX=9606 GN=UGT2B15 PE=1 SV=3
sp|P36513|UDB14_RABIT	1.45e-15	250	494	253	476	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1
sp|Q6ZQM8|UD17_MOUSE	1.93e-15	159	534	152	506	UDP-glucuronosyltransferase 1A7 OS=Mus musculus OX=10090 GN=Ugt1a7 PE=1 SV=1
sp|Q6UWM9|UD2A3_HUMAN	2.53e-15	250	494	250	473	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|P36512|UDB13_RABIT	3.40e-15	250	494	254	477	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.399028	0.600975	CS pos: 26-27. Pr: 0.5171

TMHMM  Annotations     

Start	End
5	27
515	537