CAZyme Information: FUN_001655-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_001655-T1-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
956	CP080896|CGC2	109740.88	5.4894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080896:3929247-3932866(+)

Full Sequence      

MATNVVVSMKPQDFRTCAQTSFCRRNRAYADKATSSSFISPYNVVKDTINIENGIISGEL
INTDNKVSFIFEIHLLINNIARIKINEKYPLKPRYDGAKYWSLIQEPLNTLEYTENPSTG
KDGVTFLSFGVDRNHKVIIHHTPFHVELLVNDEPVIIFNNRGFFNFEHLRKKDDPANQPE
ELTIQSEINAEVEIQTEEEKEEKQEEGLWEETFNGKLDSKPNGPESIGLDISFPGFSHVY
GIPEHASTLSLKETRGGDGAYNEPYRLYNLDVFEFDLDSPAALYGSIPFLLAHRKGASTA
ILWLNAAETWIDIVKSKDDKGFLSFGKSTPTSTHTHWFSESGIIDVFAFLGPTTSDIFKQ
YGLLTGFTALPQSFAIGYHQCRWNYLNQDDVAEVDEGFDKYDIPYDVIWLDIEHTDDKRY
FTWDKVKFSEPEKMQRDIGRKGRNMVVIVDPHVKRDDNYYIYKEAKDLDILTKDKDGKIF
EGWCWPGSSVWIDWTNPKAQEWFAKKFAFDQYKGSTEFLFIWNDMNEPSIFSGPEITMPK
DLLHYEGWEHRDLHNLFGMTFHAATSQGLINRTSPNHRPFVLSRSFFPGSQRFGAIWTGD
IAANWDHLAASSPMLLTIGISGLPFSGADVGGFFGNPEPELLVRWYQTGAFQPFFRAHAH
IDTKRREPWLFGEPYTGYIRDAIRQRYILLPFWYTLFQEASTNGMPIIRPMFVVFPDNEE
TFAMEDQYFVGNSLLVKPITSQGQTTTEIYFAGNDLYYDYYTFKKVQGSGKLKMDILMNK
IPVFLRGGSIIPRRQRFRRSSSAMYSDPFTLLVALNKKGEAAGTLYLDDGKTYEYLKGHY
IHRNFNFTSGKFISTSFNNEQVQDNENNYIKSNDDVRIERIIVLGVDKSPKKIIGYYNDL
IDDKKELKFSLGGINDIKGIVSTSIGIGVEEISKDIIIIRDPKLLISRDWTIEFVN

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	347	791	8.4e-156	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269889	GH31_GANC_GANAB_alpha	0.0	366	832	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	347	791	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	9.76e-179	223	889	139	761	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	3.00e-147	366	704	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	3.75e-113	352	841	164	644	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08390.1|GH31	0.0	9	953	27	943
KAF2113743.1|GH31	0.0	7	954	30	988
KAF2279870.1|GH31	0.0	7	954	31	983
EGX52673.1|GH31	0.0	8	952	30	965
KAF2731888.1|GH31	0.0	9	954	2	955

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	7.31e-305	9	885	5	896	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	1.18e-303	9	885	5	896	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5IEF_A	1.21e-285	13	888	5	867	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	1.25e-285	13	888	5	867	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
7KRY_A	2.81e-284	13	888	36	898	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FN05|PSL5_ARATH	1.50e-290	3	955	15	921	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	6.22e-285	5	888	29	899	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|P79403|GANAB_PIG	2.50e-284	5	888	29	899	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q14697|GANAB_HUMAN	2.28e-282	5	888	29	899	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|Q4R4N7|GANAB_MACFA	6.46e-282	5	888	29	899	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000034

TMHMM  Annotations     

There is no transmembrane helices in FUN_001655-T1-p1.