CAZyme Information: FUN_001604-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_001604-T1-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771		89185.67	7.1731

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080896:3680868-3684276(+)

Full Sequence      

MSEYNQVRLRQSGHTESEVPIQENFDDKKKETIFKKRESKPDVASRATLAVLTLLSFATR
FYNIDYPSQVVFDEVHFGKFASYYLKRAYFFDVHPPLAKLMFAGMGYLLGYDGHFEFDNI
GDDYIENDVPYVGLRALPATLGALFVPLTYMIMIESGYPIITAIFAAALVLFDNALICQT
QLILLDSMLVFFMLCTFYSYIRFCKLRMREFSNEWWIWLVASGVSLGLTIGVKMVGLFTV
MTIGVAVLVDLWNLLDINRGLTMAQFRKHFAARAIGLIIVPISVYLFFFYLHFLILNTSG
TGDVFMSPAFQETLQGNEMNLQSSEIRFNDTITLKHKDTSVFLHSHTENYPLRYEDGRIS
SQGQQVTGYLHNDTNNYWRIKPAENFFDNSRPENDTIKHKDYILLEHIGTNSHLLTHDVA
SPLMPTNQEFTTIPVDDDSRYNETIFQVHINDGESDTVWKTKSSYIRLIHYNTKVALWTH
SSELPEWGFNQQEVNGNKNNVERSNIWIANEVVGKNYTEPMEPKELKKIPFLLKYFELQR
LMISHNSGLTKPHPYSSGPINWPFLIRGISFWTNNDDRQQIYLLGNPFNWWLTVASMAVL
VGVLLADIISRRRGFEPINKPVRIRLYNSGCFFFLAWFFHYIPFYLMGRSLFLHHYLPAL
VCSYMVTSIVFNFMFVNSVNYPILISSVGSNNMSSNRPKVHSVLKAGVDYISIIIATILI
FISFGVYIYFAPLTYGTPGLDPSGIHNRRWLDTWDLHFQPKRGIYHYFFFL

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	52	293	1.8e-72	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	52	759	30	698	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	6.14e-83	50	297	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	6.24e-71	534	752	2	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	2.28e-20	334	508	3	184	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.25e-09	326	383	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW02771.1|GT39	1.89e-290	45	761	63	775
QRV73816.1|GT39	1.89e-290	45	761	63	775
QRW16888.1|GT39	1.25e-288	45	761	63	775
CDS13311.1|GT39	4.99e-279	6	758	5	757
CCA66707.1|GT39	8.00e-272	41	761	63	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	1.20e-98	51	756	70	753	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	1.25e-92	49	755	53	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	9.28e-09	343	503	25	182	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	1.23e-08	343	503	42	199	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46971|PMT4_YEAST	1.19e-212	41	759	46	761	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	2.75e-209	25	758	25	753	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	7.40e-207	46	761	59	777	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|F1Q8R9|POMT2_DANRE	1.81e-120	49	755	71	755	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|F1QF89|POMT1_DANRE	1.59e-118	49	761	18	720	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999775	0.000210

TMHMM  Annotations     

Start	End
89	111
131	153
160	177
181	203
215	232
236	255
274	296
588	610
631	653
668	690
711	733