CAZyme Information: FUN_001178-T1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: FUN_001178-T1-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		62721.03	7.8041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisC2	25634	N/A	90	25544

• Gene Location: location=CP080896:640157-642186(+)

Full Sequence      

MIKRKSLLLLLVPFLLLCVNVNTAAQNYISRGVDIDRSNIPKNILVASFPGGGSHVKPML
DIATILVERGYNVILVAPIENKTLVEYPAIKHISSGPKMSGNNGIEVNNEALTFKKMIKL
FEPGVKSYKRVYEMYKNVAEEYNIDLFFCDLVPIQNDACIDIAHTLKKPVVGLISGLLAI
DPKPYKSDPTIGCDVSLEDASILERFRCNFIQPLLMIYSFNSIVNQINDLRKQMNIEPGN
IAFGGSVKSSLIFINTFFGFEHPQNLPPYVQEIGPILSEEYPPLSPELSDFINGHERVLY
VTFGTRFITTTDNNSKLLQSFIEAINKKIVDGVVWALVKTPKDNFHPTLKLSDGTQVQTS
PILNNKHPHIHITEFAPQFSVLNHTNTKLFFSHGGVGGSHETLYTGTPVLVLPLAGDQMG
NAQKLIAAGVASSLSLNNLDIDDILNKMDSLLKDENVKKNLERLKVLAKINSKRKVRAAD
LIEYMLHSSTFIEDVNDDFLKEWFPADTRMGIIRAYNLDILTILLGITLSIIWFIIVKLI
KLFRFLLMNPTSDNRKPKIE

Enzyme Prediction     

No EC number prediction in FUN_001178-T1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	269	465	2e-25	0.42408376963350786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.66e-43	43	485	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	1.39e-22	46	547	3	493	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	1.23e-21	251	465	248	443	ecdysteroid UDP-glucosyltransferase; Provisional
224732	YjiC	1.81e-18	44	483	4	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
177813	PLN02152	4.51e-07	252	468	200	433	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI64654.1|GT1	5.39e-56	42	523	10	505
QGI59140.1|GT1	1.01e-54	36	523	3	504
QKD47039.1|GT1	1.01e-54	42	519	9	500
QGI90050.1|GT1	1.01e-54	36	523	3	504
CCT62669.1|GT1	1.01e-54	36	523	3	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	3.46e-15	274	464	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	4.33e-14	283	461	7	162	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2IYF_A	2.82e-11	349	483	265	395	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
4M83_A	2.82e-11	349	483	265	395	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]
6J31_A	6.12e-11	368	486	279	394	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A291PQH4|UGT2_DACCO	4.79e-19	249	484	237	446	UDP-glucosyltransferase 2 OS=Dactylopius coccus OX=765876 GN=UTG2 PE=1 SV=1
sp|P19224|UD16_HUMAN	8.90e-18	50	531	33	501	UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
sp|Q80X89|UD2A1_MOUSE	2.06e-17	182	464	188	444	UDP-glucuronosyltransferase 2A1 OS=Mus musculus OX=10090 GN=Ugt2a1 PE=2 SV=1
sp|Q6UWM9|UD2A3_HUMAN	6.40e-17	248	464	250	443	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|P36512|UDB13_RABIT	6.49e-17	248	460	254	443	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001657	0.998324	CS pos: 17-18. Pr: 0.3260

TMHMM  Annotations     

Start	End
7	29
515	537