CAZyme Information: FPRO_15760-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_15760-t41_1-p1
• CAZy Family: GT48
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
875		95363.15	6.2117

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000009:170577-173312(+)

Full Sequence      

MGDMESFKLPYGELLQHLTASEKISLLSGNYPSPSSITRTPLINQCRYFLGSDFWHTQGI
PRLSIPKLRMSDGPNGVRGTRFFNSVPAACLPCGTGLAATWSHDMMREAGDLIARGCHAK
SAHVWLGPTTNTQRSPLGGRGFESFSEDPLLSGSLASALICSVQKNGIACSLKHFVANDM
EHERTLVDCRISPRALREIYLLPFQIAIRDADPWAIMTAYNKVNGQHMSEHQEILQQILR
NEWGYQGCIMSDWFGTYSTAAAINNGLDLEMPGPTEQRGKQVATALGVGKISSSTIDARA
ASVLKLADRVRASGILESGPESCPDTNQDRSVLRRLATESVVLLKNDGHILPFRVDKKAK
QTVVIGPNSQKSFFCGGGSASLRPTRVVSILEGLQGQVEQPLEHTEACQIYNQLPVLGDI
VTAPDGTRGQFLMKFYTSPPTMRLNNSEITGAREAIDVLQLDDSNVVLYDYSNPAAPDNV
VYATITADLVVENTDIYAFSLAVAGTATLYLDDDLIVDNSHDQKRGTSFFGSGSDERINH
VQLVASRVYKLRVEFGSATTSSLTKAGAPVFGAGGVRIGCARYSDESRELDRVVELAKAA
DQVVVCVGLGPEWESEGSDRSLYELPGRQNELISKVTGVNKNVVVIIQSGTPVSGPWDQV
PAVMQTWYGGNELGHGIADIVFGRESPSGKLPLSWPRVIEDNPSFLSHISEAGICYYNED
IFVGYRFYEVTKRKVQWPFGFGLSYASFILGQPSVQIRGSGVEASMLVTVPVRNNSVTTS
GKEVIQVYMSCVTPSAVKRPIKELKGFTKLFVPASEMRQATIEIPLKTAVSVWDVTTDSW
LMESGTYKLSVGNSSDSALLSTQFQVPVTQHWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	59	272	2.9e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	9.38e-64	53	403	48	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.98e-59	62	858	101	755	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	3.72e-49	572	725	63	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.48e-35	62	306	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.11e-30	14	824	56	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75990.1|GH3	0.0	1	875	1	875
QGJ02135.1|GH3	0.0	1	875	1	875
QGI71242.1|GH3	0.0	1	875	1	875
QGI88576.1|GH3	0.0	1	875	1	857
QKD57157.1|GH3	0.0	4	875	1	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.21e-234	8	875	3	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.32e-231	8	875	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.15e-116	51	869	23	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.71e-112	29	855	4	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	8.58e-84	13	855	56	817	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	2.52e-251	51	875	24	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.86e-250	51	875	24	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.15e-249	51	875	24	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.62e-249	51	875	24	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	2.24e-245	13	875	16	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRO_15760-t41_1-p1.