CAZyme Information: FPRO_15661-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_15661-t41_1-p1
• CAZy Family: GT4
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		64213.13	8.4779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000009:444038-445880(+)

Full Sequence      

MQLCTWIISGFVTAIAATETYDYIIVGGGTAGGALATRLSLGLPKSKILLLEAGPEALDD
VRINVPGMRGSILGSSLDWNFSSIAQPGLNGRSISVNRGKVLGGSSAMNFLCYDRATSAE
YDAWSGLGSPGWNWDVMIHGMKKSENFTGSDGDVHGRSGPISSTYNRIIPDVLKPWQSTV
NKLGVPINDGGSLGGNPVGVMFQPTNIDVTNYTRSYSANSYLPKAGLNLEVKTNAHVAKV
LFSSKKSKGLIATGVALQDGSTIKARREVILSAGSIQSPGLLEMSGIGQAEVLAKAKVKQ
LVDLRGVGENYQDHLRTSNTYILKEGYESFDQMIFKPEGALAKEQFNLWLENKVSWYDYT
SSAYAFLTWAQVSDSVGRKMNQLAKDGFAINGTVVDKKKLEYLSDASIPQLELLLEANYV
GAQGYPGTSPNFITIFSSIMHPMSRGSVHINGQDVKSKPIIDLNYLNNEYDIQALIEGAR
FARKVAETEPLRSVWAAEFEPGLGKRTDAQLRDWVVKTVNSFYHPVGTCAMLPKKDGGVV
DSNLKVYGTKNLRVVDASIIPVQLSGHVQTAVYGIAETAAQKIIAAEKEYVKGL

Enzyme Prediction     

No EC number prediction in FPRO_15661-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	584	1.2e-172	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.01e-86	17	583	2	531	choline dehydrogenase; Validated
225186	BetA	4.82e-83	16	583	3	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	2.07e-48	22	581	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.71e-43	442	579	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.22e-29	90	315	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI71157.1|AA3_2	0.0	1	594	1	594
CCT75908.1|AA3_2	0.0	1	594	1	594
QGI88492.1|AA3_2	0.0	1	594	1	594
QGJ02050.1|AA3_2	0.0	1	594	1	594
CEI41892.1|AA3_2	0.0	1	594	1	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.44e-77	18	583	3	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	7.47e-72	19	587	15	591	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
1GPE_A	5.57e-63	17	584	21	580	Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense],1GPE_B Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense]
4H7U_A	1.44e-62	21	583	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6O9N_A	1.58e-59	19	584	34	639	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	1.48e-95	19	584	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.48e-95	19	584	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	4.78e-83	17	583	36	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.67e-76	22	585	15	618	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.77e-75	21	583	14	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.802807	0.197219

TMHMM  Annotations     

There is no transmembrane helices in FPRO_15661-t41_1-p1.