CAZyme Information: FPRO_15275-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_15275-t41_1-p1
• CAZy Family: GT31
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	FJOF01000009|CGC25	67961.35	7.4952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000009:1359772-1361622(+)

Full Sequence      

MVVVKVSALFLGLASLIVPVSGQAVNDVADAFDLTQVSLTDSRWMDNQNRTLNYLLSVDP
DRLLYVFRKNHGVDTKGAQTNGGWDAPDFPFRSHVQGHFLSAWTQCYASAGVKECGDRAT
YFVQELAKCQANNAKAGFNKGYLSGFPETDISKVEDRTLNNGNVPYYAIHKTLAGLLDVY
RRMGDQTAKDTMLSLASWVDTRTSKLSYNQMQSMLQTEFGGMNEVLADIAFYTKDTKWLK
VAQRFDHAVIFDPLQQNTDKLSGLHANTQLPKWIGALREYKVGGDKKYLDIGRNAWNIVV
NKHTYAIGGNSQAEHFRAPDAIAGYLTDDTCEACNSYNMLKLTRELWALNPTDASYFDFY
EKALLNHLLGQQDPSSDHGHVTYFTPLKAGGRRGVGPAWGGGTWSTDYNSFWCCQGTGVE
TNTKLMDSIYFHTSDTLYVNLFTPSKLNWSQKKVSITQKTDFPESDTSTFKITGDTSEWT
LAVRIPSWASKASIKINGQASNVAIESGKYATIKRQWKSGDTVTVQLPMSLHTVAANDDQ
TLGAIAFGPVILAGNYGQSTLNGNPTIDLASIKRKSNAGLTFEATSGGKTVELGPFYDAQ
GFNYAVYWKLSGKLSG

Enzyme Prediction     

No EC number prediction in FPRO_15275-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	36	553	9e-201	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	4.62e-175	36	553	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	5.85e-109	28	557	3	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI88156.1|GH146	0.0	1	616	1	616
QGI70817.1|GH146	0.0	1	616	1	616
QGJ01707.1|GH146	0.0	1	616	1	616
CCT75545.1|GH146	0.0	1	616	1	616
BDF83160.1|GH146	0.0	1	616	1	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.08e-116	15	613	9	653	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.12e-111	15	613	9	653	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
4QJY_A	7.93e-16	284	551	284	558	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	3.16e-14	273	537	304	587	Glycoside hydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

FPRO_15275-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999764	CS pos: 22-23. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in FPRO_15275-t41_1-p1.