CAZyme Information: FPRO_15228-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_15228-t41_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		59902.66	5.9026

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000009:1472647-1474411(+)

Full Sequence      

MASPIYDYIVVGGGLAGCVLSSRIREYDDAAKILLIEAGKETRGRSDVHNMQVLNLGGEL
DWQYQSEPVEALMGRQITLNAGKGLGGSSAINSGGWTRGAAADYDAWAALVGDERYSYKG
QLPWFRKSELWFDDKNPEQHGRDGPIRVTCAKASNRVFPLAEKAAAGWEELGVSTLPDGD
QNSGNNLGRAYICEARSDGKREWSANQYSLDGVQVRLETFVNRIVTQKIDGNLKATGVEL
ADGNVVNGHNIIISAGAFRSPQLLQLSGIGPKTHLQEFGIEPLIDLPEVGKNLSDHMIFF
QHWRLRNTSAGHTIGSSNPLFQQHQYSQGVPFDWIVNTGIPREGLAKAIERDEGTKPRES
EHVLLTKDRTFVENIIMFAKLPFPGVPMDAEHITSALVSFLPTSTGSVSLKSGKPGEHPK
VDLNYLSTEVDKHVFREGLRQLTRFMLESKFSDQIIGESIPEGLPVGALALDDNDAKLDQ
RIAMTGGTSWHPSGTCSMGKVVDTEFCVRGVEGLRVVDASVFPVPLSAHLQAPLYALTEQ
AAAIITRKV

Enzyme Prediction     

No EC number prediction in FPRO_15228-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	546	6.5e-134	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.18e-88	1	545	1	531	choline dehydrogenase; Validated
225186	BetA	1.02e-82	1	545	3	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.00e-35	402	541	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.13e-30	6	522	56	553	Protein HOTHEAD
366272	GMC_oxred_N	2.48e-25	6	298	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI70777.1|AA3_2	0.0	1	549	1	549
CCT75503.1|AA3_2	0.0	1	549	1	549
QGJ01668.1|AA3_2	0.0	1	549	1	549
QGI88121.1|AA3_2	0.0	1	549	1	549
QKD62572.1|AA3_2	0.0	1	549	1	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	9.09e-59	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	9.09e-59	2	548	1	563	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	9.09e-59	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	9.09e-59	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.22e-58	1	548	19	579	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	3.33e-88	3	542	2	515	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	4.88e-65	6	542	5	530	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q6D6D9|BETA_PECAS	5.88e-64	6	548	3	532	Oxygen-dependent choline dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=betA PE=3 SV=1
sp|Q13NG7|BETA_PARXL	1.66e-63	1	542	1	529	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|P0DO29|ERIK_HERER	4.97e-63	1	545	29	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999729	0.000309

TMHMM  Annotations     

There is no transmembrane helices in FPRO_15228-t41_1-p1.