CAZyme Information: FPRO_15105-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_15105-t41_1-p1
• CAZy Family: GT22
• CAZyme Description: probable endoglycoceramidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		52336.92	6.0924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000009:1802177-1803624(+)

Full Sequence      

MARIKHVNQDTHQIIDEYGRTRFFHGTNVVMKESPWYRPFEWTPGVSSFGERDVQNMHDL
GLNIVRLGHSWAGAEPLRGEYNQTFLDIMKKQTKLAEEHGIYVLVDVHQDVLAKQLCGHG
VPDWFVKKDWITGFRRFPFPQKLKPFTTDSDGFPSPQSQCGTIDWSLSYLSVAVGNAFGR
LYNNFDGLGDAFAAYWKKLASQYVDTTNVVGYNLLNEPWAGDTYADPTILVPGVADRKNL
EGLWNRASKQIRTVDNDTLIWFEGTTFDVLSGFNNVPLGDGSKTVHSFHYYNPPQLGPLK
DTLYNRHKDNIRLKTAGVLTELTFWMGDDKQMASLAEAMSATDENMVSWIGWAYENLYNG
TSGKPYPELEKHYSRAYPAAIAGTPTSFGFDEALGIFKLNFTSDPTIGAPTEIILPTSAF
PNGYEVRILPSSSLLQYKPDDRTLALFTSKVFKKGTELSVEISSN

Enzyme Prediction     

No EC number prediction in FPRO_15105-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	23	354	2.6e-147	0.9969135802469136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	3.51e-19	375	448	1	74	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	6.59e-11	30	354	13	268	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	7.55e-08	37	114	2	86	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
224786	GanA	0.001	37	130	22	103	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75388.1|GH5_27	0.0	1	464	1	464
QGJ01570.1|GH5_27	0.0	1	464	36	499
QGI70680.1|GH5_27	0.0	1	464	36	499
QKD62446.1|GH5_27	0.0	1	464	1	464
QGI88025.1|GH5_27	1.19e-314	1	464	36	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CCU_A	1.14e-27	10	428	47	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	1.55e-27	10	428	47	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSW_A	5.65e-25	16	426	39	447	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	1.03e-24	16	426	39	447	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	8.06e-14	14	383	32	415	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9GV16|EGCSE_CYANO	1.17e-93	7	462	34	500	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	3.36e-86	7	453	25	473	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	5.50e-27	10	428	39	438	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRO_15105-t41_1-p1.