CAZyme Information: FPRO_15074-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_15074-t41_1-p1
• CAZy Family: GT20
• CAZyme Description: related to SUR1-required for mannosylation of sphingolipids

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	FJOF01000009|CGC18	41442.66	6.5557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000009:1876207-1877342(+)

Full Sequence      

MSSSPILGPERKNSYDEERLEWATPSVPKKYLRLPRLRRSTVILLLIDFLIIAVLVHAFY
PLITLLRRNEELFGARLTLPLNDTSFGEDVPAQRTIPRIFHQTSANETIPEAWKDLVKSC
RETYSEFEYKHWTDAKARDFISEEYPWFLDTWDTFPFNIQRADAIRYFVLHHYGGIYLDM
DTLCNATIPLHRIEADGTKHHAVFKSTTPTGVSNDMMITSAHHPAFTKALSRIQLYNDIT
RPWAHILPHVAVMVSAGPLFLTMALKNYLLEQPSLPETTIQVINATELEPYLTDYEGASW
HHGDTKAIMWLGDHSWVWYVLTVIGVVGGLYLINMLLMKCWARFFEKASSDEAKDAIKLT

Enzyme Prediction     

No EC number prediction in FPRO_15074-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	112	188	1.9e-22	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.19e-43	89	322	75	301	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.57e-20	110	189	1	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI70654.1|GT32	2.19e-269	1	360	1	360
QGJ01544.1|GT32	2.19e-269	1	360	1	360
QGI87998.1|GT32	2.19e-269	1	360	1	360
CCT75359.1|GT32	2.19e-269	1	360	1	360
QKD62461.1|GT32	6.19e-260	1	360	1	360

PDB Hits     

FPRO_15074-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	1.71e-49	69	314	55	295	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	2.53e-46	77	359	27	310	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.70e-44	37	314	1	273	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.52e-41	96	325	57	276	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.34e-40	78	315	45	276	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000007

TMHMM  Annotations     

Start	End
41	63
243	265
316	338