CAZyme Information: FPRO_14923-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_14923-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743		83092.78	6.7655

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000009:2226533-2228907(-)

Full Sequence      

MKMHLHFVFLFAIRFSVAAHIFVDRKGQDYNPGSAGKPVKSIRKAQELVRELIPSAQDDI
TVHLGPGTWVINEPIKFNSEDSGTNGLTVTWAGSDTVISGGHKIIDWTEGKNGIWSASVP
KGTKSRNLYINGLAAQYARRRIHNRTDFEYTKIGMTWNSSDYDWIMNTPGIENGELRAIN
SFTDRVALIEKVSNRVLEMKKDIWANQLIGYDQIAEPFWDGGVWIQNVKALLTDGGQFYL
DRNESTVYYKPLEGEDMATVSGYLGIQEVLMVVGGTYKEPIHDLHFEGIAFKHSTWLRPD
TYGYIDQQTGGYMGNDSQWPNFEASRPHWWQMPSAIQVSAAYNVTIESCTFRELGAGGIG
VGNDKNAHVTGVGLGANNIHIDDNYFTQVMGNSITVGGIQADAHHPSQPQMLVSDIHASN
NIFNNNSVLWSSTVPILFTYTQFSSIIHNDVYNQPYSGICHGYGWGSNDEGGSPEYVKRG
LYNYQPLYDTPTVMKNNLIEGNLIHHFGQSHTDFGGVYTLSRSPNTMVSSNLIYDASWQA
LYPDEASRNITWFNNLGFTSGKYYAPNDWIPEQLTGWNTVIANWGKLGVKDNEVLDGFPN
HSGRRNNTFLRNYLAPYINGTSLIAQRAAYRAGVTPSKRKGRPITNDPNIADAYLDVKVS
DGHVVVNVTNFDDWDFRDVVFRISGRGITFTRKFTPHSIPADGSAAAVYTFSGSPKGNAT
AWVSYANPRTQRYRREKEFSLTM

Enzyme Prediction     

No EC number prediction in FPRO_14923-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	20	555	3.2e-132	0.9848197343453511

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404168	Beta_helix	9.52e-05	334	459	1	118	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
404168	Beta_helix	3.00e-04	375	565	7	141	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGJ01406.1|GH141	0.0	1	743	1	717
CCT75177.1|GH141	0.0	1	689	1	670
QGI87871.1|GH141	0.0	1	743	1	673
QGI70516.1|GH141	0.0	1	743	1	673
QPC65644.1|GH141	0.0	1	743	1	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	3.16e-44	18	567	24	590	Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

FPRO_14923-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000569	0.999395	CS pos: 19-20. Pr: 0.7539

TMHMM  Annotations     

There is no transmembrane helices in FPRO_14923-t41_1-p1.