CAZyme Information: FPRO_14649-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_14649-t41_1-p1
• CAZy Family: GT17
• CAZyme Description: related to alpha-L-rhamnosidase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802		87097.54	7.5553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000008:2383798-2386258(-)

Full Sequence      

MLLQATASLLLVAGSALAGPAARADKNVVIYGSKGTVSLSSDGKKPHIMILDYGENVEGH
PTFEVASASGDTSAFELTYAESKYAFSNYQSDGPLPLAAAMDTYRVNRYNISKRETFNHR
LVQGAFRYQKLNLSSNGELRLKRIGVKPTVHTTPLTKLPGGFECSDEDFNRIWLTGARTA
QLTEIPKNTIPDFWEVSKEGSLVESSAPQALGSAAAAQLTAYQLDFQVKPVTGEFTFSVL
SDTLNEAIIVTCDVKTGKVTATGASKSGSIPSSADAKVGEWMSVHAKVNMTEISVVVNNK
TVLDFTQTDKFYGSFGLGVPLGHSAYFRNLKAATLDGTEIYSNNLTDPSFLKDFFMGTNP
ADTIVDGSRRDRIAYTGDLDVALGSTYASTYGKSFVEGSLDLLGSYQATPGFFIPTAKIQ
QEPLKEVLDVNITGLIGYSFNFLNALAKNYEVLGDKKFAKKWAPRTTAMLDWAHSQLRNG
LFTLDDTAFTGDWNYYDPPQTGASSKFNALYAYSLQQTEPLLKDAGVNTTVYQTRLDNLR
KAIHSNLWNDTLQAYVLSNEITTGLAQDANALAILAGIPQSHNISATSLLSTMNKELQLK
AGPLAFSNATAKSGFAQKISPYSSAYHLRAAFESDDDVIVKRLLKSLWAPMASPAHANYT
NCFWETLDPDGTPGLGIITSLCHGWASGPTAELSRHVLGVQAVEPGYKKWDVKPLTLGLE
WAKGRVPTEHGNIEVDWKFKSGLLQMTVRGPKNGDTEGTVYLPRPLPTPLEKSVIKVNGK
VVKGERFTVSCGQKVTIKQSRA

Enzyme Prediction     

No EC number prediction in FPRO_14649-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	359	761	2e-67	0.7341269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	3.61e-13	699	764	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	5.91e-05	450	582	111	242	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
399445	DUF1080	6.06e-04	174	331	11	180	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75036.1|GH78	0.0	1	802	1	802
QGI87784.1|GH78	0.0	1	802	1	802
QGI70426.1|GH78	0.0	1	802	1	802
QGJ01315.1|GH78	0.0	1	802	1	802
QKD60287.1|GH78	0.0	1	802	1	802

PDB Hits     

FPRO_14649-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P9WF03|RHA78_ALTSL	3.07e-08	339	757	467	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000270	0.999712	CS pos: 18-19. Pr: 0.9653

TMHMM  Annotations     

There is no transmembrane helices in FPRO_14649-t41_1-p1.