CAZyme Information: FPRO_14639-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_14639-t41_1-p1
• CAZy Family: GT15
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831		92093.26	4.9878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000008:2360971-2363466(+)

Full Sequence      

MTPTNDLVSKLTVEEKVSLLAAVDWWRTPTIKRDDVFVPHIKMSDGPNGARGESYVSGIT
AACFPCSTAVGASFDTEQAYRLGKEIAKETKTKSANVLLAPTMNIIRSPLGGRNYETYSE
DPYLIGTLASAFVRGCQSEGIAATPKHFVANESEKSRTKMTSNIDRQTLREIYMLPFQLV
MRDSDPWCFMTSYNRLNREYCAESHWLLEEVLRKEWRFSGLVVSDWMGTYSTAQALNSGL
DLEMPGPTRWRGEKLLKDIEAGTVTLETLNKSVSRVLELAQKTGRFEDPVEKPERSVVDP
ERLEFITSIAADGMVLLKNDDNILPLPSKASVAVIGHHALHPSIGGGGSAKVLAQHIISP
LEGLKAQGVDCRHAPGVPVFGALPHAQPEIISPVQLRWFNSSAVGENVAHEQTIVLPEYM
IKEAWPAYLSKEYCTSMSFTLRPTTSGSHVFSVITTGKADVFVNGDKVFHRPQEPVLLPE
SFYFYKAKIERRFTLSMEAGKEYKIELHSWATDPEVLSKIGGTMFQGASLRFMEHVDIPG
AIQDAAEIAASSDVAVVFVGTTNELESEGYDRDTMDLTSDQYELIDAVVASNPRAVIVNL
SGSPITVSPIIDQVPCFLQAWFAGQECGHAIARVLLGHVNPSGRLPMSWPKRNEDNPAYP
NFPCDDNLELNYEERLKVGYRFYDDGDAPEPQFHFGEGLSYTTFELAGPVSANSKFGSPD
TTETSLVLEVKNTGTRDGKQVVQLYVTPPPCDGNSRPVKDLRSYCKVFIPAGQTEEVTFN
LDKYAFSYFDADVDKWKIPQGEFLLHVCFSSAETPQTVSIKNMETQYWTGL

Enzyme Prediction     

No EC number prediction in FPRO_14639-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	38	245	4.3e-63	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.84e-70	64	816	120	759	beta-glucosidase BglX.
224389	BglX	1.85e-66	38	379	60	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.69e-52	314	680	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.01e-43	64	279	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.28e-38	7	807	56	768	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI87776.1|GH3	0.0	1	831	1	831
CCT75026.1|GH3	0.0	1	831	1	831
QGI70417.1|GH3	0.0	1	831	1	831
QGJ01306.1|GH3	0.0	1	831	1	831
QKD60297.1|GH3	0.0	4	831	7	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.43e-163	5	831	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.51e-159	5	831	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.16e-125	7	821	8	667	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.38e-109	4	813	5	654	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	5.91e-97	6	813	56	819	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	1.62e-178	8	831	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.54e-177	8	831	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.54e-177	8	831	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.59e-177	8	831	10	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	3.47e-176	5	807	12	823	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999949	0.000107

TMHMM  Annotations     

There is no transmembrane helices in FPRO_14639-t41_1-p1.