CAZyme Information: FPRO_14524-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_14524-t41_1-p1
• CAZy Family: GT1
• CAZyme Description: related to SPR1-exo-1,3-beta-glucanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	FJOF01000008|CGC21	47082.53	8.3300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000008:2105114-2106490(+)

Full Sequence      

MHLKSVLPFFLAGAEAWTPQSRAIAKANGEKIIERWLPNDDKIRGVNLGSQFIIERWMAE
ESWKNMGCSAYNDEWACVKGIGQEKANAAFKKHWETWITEDDIKQIASIGLNAVRIPVGY
WMYEDIIQKGEYWPRGGIWHLDRIVGWCKKHGIYAVIGLHSAPGISSPNEQFTGHSIPNP
GFYTAENYERAFKFLEWMTKRIHTNGNYTTVGMLEVLNEPVRAGKWKAEADDMIKNYYPG
AYKRIQAMEGYLKVPKADRLHIQYMGKSWGAGDPRLYLPDDDLIFFDAHRYLSFDNRITG
NKKAYIETACQDNMGRHVFVGEWSLSVNSTLKNTDEFKIQGQETWYKAYWAAQAESFEKG
DGWFFWSWKCDGELGKKDWRWCYQAAVAAGVIPKDAGKAKSLSPCARYTK

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	82	384	1.8e-141	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.27e-18	26	363	2	325	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.12e-12	95	368	22	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74918.1|GH5_15	0.0	1	410	1	410
QKD60398.1|GH5_15	1.23e-314	1	409	1	409
QGI70318.1|GH5_15	6.93e-313	1	406	1	406
QGJ01207.1|GH5_15	6.93e-313	1	406	1	406
QPC76097.1|GH5_15	8.89e-285	1	408	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.56e-32	36	394	2	380	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	5.64e-32	36	394	2	380	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	6.20e-32	36	394	8	386	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	8.41e-32	36	394	7	385	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.62e-31	36	394	8	386	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	1.50e-129	3	405	1	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|A1DGM6|EXGB_NEOFI	1.15e-121	14	405	15	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	8.53e-120	16	405	20	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	1.83e-119	16	395	18	391	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|B8NBJ4|EXGB_ASPFN	1.38e-115	16	390	18	386	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.860774	0.139270

TMHMM  Annotations     

There is no transmembrane helices in FPRO_14524-t41_1-p1.