CAZyme Information: FPRO_13919-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_13919-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: related to glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852		92468.41	6.4191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000008:617447-620438(-)

Full Sequence      

MKLLLPLLLLTSQSLAGTIKLAHRASLGPIGTSNPNILAGGTVQTDAPPLSSFFKDLKGP
YPTNGWWAPYAASPGKGTAAGPFPYESSLDGHGVCFGIGQDRNFDGTSIKVPTQLDWRAS
FSEHSGGFDGHKATAFDTQTVTVQYFQGDSSMAAHLVPGSPYVTFEYKSATPLLTTLNGG
IKSFNGKAMSGSNTVSDQGTKFTVVDTKGTTYLIYSDSSIKLTAKAENDNKGTLAADGKF
TGILRLVMLRDPSHETLLDAHSTVYPISVSQDYSISGDSGTVTFKWETKGTGDLLMLTWP
HHREVLQSPNSPEPSALSYLTLKGWMYPTLGNTWRLTYKLTSITWNAPRDVDPSCKSSVV
NGLKYEVSQLDASKAPAANDFYYWGGTLAAKSRLALIADHVGSKDLIDPVIKYLKASFDG
WFSAANKALPAYETTWGGVISKEGATNVWVDFGNGYFNDHHFHYGYFLHIAAVIAKYDPS
WLAQHREYVTFFARDIINPSSADPFFPITRCLDWFAGHSWASGIANGAGSRDQESVGEAV
NGYYGAMLWATVALDQEHANFARLLLAIEQQAARKYWHLYPSAGKDDPTNPYPEVKFRDL
ITVGNVMDWQTGAWLFWGAEKVQIAAIQILPVTPVNEVMYDAEWVSNVFSYTMPELTNAS
YADSWKSVIYAAYANAKPQEAATWSAKLSDWGSGNTYTNELYFISTRPNSNGQPICATLP
ENPYGDYKIQATSGKYIVSAANGGQLSASSASANDADTFSSAYVPNAGTLQLARNKQYVT
ADQSGTFALSAARAVASTWERFIIRQKIGESEGVYSIKAASNGKYVRVGGDGTLVNDGAA
ENEATGFRFIKA

Enzyme Prediction     

No EC number prediction in FPRO_13919-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	55	703	2.6e-124	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	7.29e-72	356	681	7	325	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	4.19e-71	27	698	49	746	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	7.15e-28	140	344	107	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
238160	Fascin	6.13e-04	773	847	8	76	Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF)
399343	Fascin	0.007	734	834	2	96	Fascin domain. This family consists of several eukaryotic fascin or singed proteins. The fascins are a structurally unique and evolutionarily conserved group of actin cross-linking proteins. Fascins function in the organisation of two major forms of actin-based structures: dynamic, cortical cell protrusions and cytoplasmic microfilament bundles. The cortical structures, which include filopodia, spikes, lamellipodial ribs, oocyte microvilli and the dendrites of dendritic cells, have roles in cell-matrix adhesion, cell interactions and cell migration, whereas the cytoplasmic actin bundles appear to participate in cell architecture. Dictyostelium hisactophilin, another actin-binding protein, is a submembranous pH sensor that signals slight changes of the H+ concentration to actin by inducing actin polymerization and binding to microfilaments only at pH values below seven. Members of this family are histidine rich, typically contain the repeated motif of HHXH.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74359.1|GH81	0.0	1	852	1	852
QGI69792.1|GH81	0.0	1	852	1	869
QGI87134.1|GH81	0.0	1	852	1	869
QGJ00681.1|GH81	0.0	1	852	1	869
UKZ70759.1|GH81	0.0	21	850	28	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.65e-56	115	719	113	730	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.20e-56	115	719	138	755	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.40e-55	115	719	113	730	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.99e-38	49	681	21	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.02e-25	23	692	2	666	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	2.68e-54	136	697	125	694	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.04e-48	137	681	168	707	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	1.98e-40	132	684	318	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	6.48e-39	134	648	521	1054	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.29e-33	251	669	326	736	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999792	CS pos: 16-17. Pr: 0.9523

TMHMM  Annotations     

There is no transmembrane helices in FPRO_13919-t41_1-p1.