CAZyme Information: FPRO_12920-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_12920-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: related to peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	FJOF01000013|CGC3	57472.99	8.8425

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000013:855008-856654(+)

Full Sequence      

MKGSTTLAFTLVQLSAASQLVWPSKWDEVEDLLYMQGGFNKRGLADALRTCEFGSNNPGQ
QNTAEWLRTAFHDVITHDAKAGTGGLDASIYWESSRPENPGKAFNNTFSFFSGFHNQRAT
ASDLTALGTVLAVGACDGPSIPFRAGRVDAYKAGPSGVPEPSTNLKDTFSAFTKAGFTKE
DMTAMVACGHAIGGVHSVDFPEIVEIKADPNNDTSVPFQKDITSFHNGIVTEYLAGTSKN
PLVAAKNATFHSDKRIFDNDRATMKKLSAKAGFNNMCADILTRMIDTVPKSVQLTPVLEA
YDVRPYITELSLNSKGKMHWTGTVRVKITNNIRDPNDLAINLIYSGRDGKKVTVPTQQVT
FQGGTSSGAGQLFANFQFDTTLDAKNGITKFWIQEVKPSTKATVTHDNQKTGGYKVDDTV
LYQLQQSCAVLESLPNAPLVVTAMVRDARAKDPLTLRVAHKKPVKGSIVPKFQTEITNFK
ATGKKSAGFTAFQAKTKFEEQSTYFDIVLGGNPASGVQFLPTQAMPDKCS

Enzyme Prediction     

No EC number prediction in FPRO_12920-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	46	222	2.7e-26	0.6862745098039216

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	2.51e-110	22	286	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	1.53e-20	64	285	19	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	6.97e-17	64	196	17	155	Peroxidase.
173825	ascorbate_peroxidase	6.52e-13	67	196	34	168	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173826	ligninase	1.11e-11	44	199	20	183	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68923.1|AA0	0.0	1	530	1	530
QKD59397.1|AA0	0.0	1	530	1	530
QRW22025.1|AA2	3.32e-109	16	529	15	535
QRV94524.1|AA2	1.51e-99	7	492	7	491
QRV79935.1|AA2	1.43e-96	7	492	7	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S6V_A	3.18e-06	67	196	47	181	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],1S6V_C Chain C, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],2N18_A Dominant form of the low-affinity complex of yeast cytochrome c and cytochrome c peroxidase [Saccharomyces cerevisiae S288C]
4NFG_A	3.18e-06	67	196	47	181	K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex [Saccharomyces cerevisiae]
4CCP_A	5.70e-06	67	196	49	183	X-RAY STRUCTURES OF RECOMBINANT YEAST CYTOCHROME C PEROXIDASE AND THREE HEME-CLEFT MUTANTS PREPARED BY SITE-DIRECTED MUTAGENESIS [Saccharomyces cerevisiae]
1CYF_A	7.59e-06	67	196	49	183	Chain A, CYTOCHROME C PEROXIDASE [Saccharomyces cerevisiae]
3E2N_A	9.66e-06	67	196	40	174	Chain A, Cytochrome c peroxidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.40e-70	22	438	23	461	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q7XZP5|APX5_ARATH	1.25e-14	67	274	34	243	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q42564|APX3_ARATH	4.62e-09	67	274	35	245	L-ascorbate peroxidase 3 OS=Arabidopsis thaliana OX=3702 GN=APX3 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	3.53e-07	67	193	118	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q6C0Z6|CCPR_YARLI	1.55e-06	67	196	96	230	Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.697934	0.302088

TMHMM  Annotations     

There is no transmembrane helices in FPRO_12920-t41_1-p1.