CAZyme Information: FPRO_12841-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_12841-t41_1-p1
• CAZy Family: GH49
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	FJOF01000013|CGC7	64260.23	6.3101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000013:610162-611904(-)

Full Sequence      

MTVKNGTYFDFIIVGGGTAGNIVAARLAENPNARILVVEAGIGTSKDNEEIRTPGLAMDI
RGSKYDWAYKTTMIKRDDYERIEKPNTRGKALGGSSSLNYFSWVPGSKGTFDMWEEYGGK
EWTWEPLVPYLRKSVTYHDDAGLYAPELKKIGAGGPIPIAHAELMPEMKPFRELLTTAWK
STGEPVSENIFDGTMRGLVHSVNTIYKGRRSGSFLAVAGKQNITIFPEVHSKRLIIDQAD
RTAKGVTVITASGEELDLYATREVIVSQGVFETPKLLMLSGIGPKAELAKHSIPLLVDSP
HVGQHLLDHPGVPFVLKIKDSYSMDNHVLRKGALQDKVMSAYANGHAGPMGSPFLEMIGF
PRIDSYLEKSPEYRAAKAANDGLDPFCPYGQPHFELDFIPLFGSAFQWHFPHPNKGSYMT
VMVDLVRPVSEGGEVTLNSADPLQQANINLNYFNNDLDIIAMREGIRFSYDVLKNGEGFK
DIVEDEYPWDMPLHDDEAMKRTVLDRSQTSFHPCGTARLAKSIEQGVVSPSLQVYGVKNL
RVIDASVIPVIPDCRIQNSVYMVAEKGADAIKRDHADLYR

Enzyme Prediction     

No EC number prediction in FPRO_12841-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	574	1.2e-146	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.00e-81	9	576	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.35e-77	9	580	6	546	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.30e-37	428	566	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.19e-20	9	563	56	568	Protein HOTHEAD
366272	GMC_oxred_N	1.94e-18	88	310	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68848.1|AA3_2	0.0	1	580	1	580
QGI99737.1|AA3_2	0.0	1	580	1	580
CCT73322.1|AA3_2	0.0	1	580	1	580
QKD59313.1|AA3_2	0.0	1	579	1	579
QGI86218.1|AA3_2	0.0	1	580	1	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	6.47e-316	5	579	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.85e-315	5	579	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	5.30e-315	5	579	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	9.55e-66	9	574	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.11e-65	9	574	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	6.07e-54	5	571	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	6.07e-54	5	571	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|B1Z034|BETA_BURA4	1.27e-53	9	572	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.59e-53	9	571	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.65e-53	9	576	41	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000033

TMHMM  Annotations     

There is no transmembrane helices in FPRO_12841-t41_1-p1.