CAZyme Information: FPRO_12717-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_12717-t41_1-p1
• CAZy Family: PL9
• CAZyme Description: related to mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	FJOF01000013|CGC6	49766.04	5.7464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000013:274882-276495(-)

Full Sequence      

MAHQYVLPVVFLRPSRRIRLLAFLSFFVTATWTFITRSSIVCSQERDIAREYPLVYRHIH
SFNGTGGAWYIPPYWADTEQPQNILDAARIVSQSALSNRERRILFSNIPLIVHQTWKTTA
ADNWNPRILPWVELWLENSIYADRGPSMAYLFWDDTGMRALVEEFENDFLERYDSLLTPV
ERSDVFRILVCKHFGGIYGDLDTELIRHPAAWISGSDMASWTDPKTGKAYGFYITSVTPD
YETPVVNLLWGLEADNDPESDAYWRQSYTYPQQLSQWAFAAAPEHPVFERYMENLRNYTI
DNETAVQNSDPLKRTGPAAVTLATKSWLEGQVGFRWTSLTGVKDGGKSKLVEDILILPIT
GFHPSHGSRNDVMGRRPMTDPAARLCHHGTGLWKHFNFVGEYGKCQLAETQRVPSYGGSD
PHDPILKEEDEDFR

Enzyme Prediction     

No EC number prediction in FPRO_12717-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.14e-18	108	296	82	244	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.08e-09	146	217	16	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73207.1|GT32	0.0	1	434	1	434
QPC63324.1|GT32	3.18e-223	1	404	1	406
QKD59215.1|GT32	1.64e-192	78	362	3	287
CEF84399.1|GT32	9.73e-183	31	362	14	347
CZS74875.1|GT32	1.38e-182	31	362	14	347

PDB Hits     

FPRO_12717-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.09e-22	106	394	140	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q10323|IMT3_SCHPO	6.88e-10	108	231	57	177	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	8.70e-08	108	217	82	188	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.33e-07	108	202	55	140	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.73e-07	108	202	62	147	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999190	0.000825

TMHMM  Annotations     

Start	End
20	41