CAZyme Information: FPRO_12584-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_12584-t41_1-p1
• CAZy Family: GH47
• CAZyme Description: related to acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28692.72	9.3021

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000015:788906-789676(-)

Full Sequence      

MYSRQLISRSRQKFITGQCPFQIRVISTISNKVNQASVTVHSTQATSPNVVLRLMPLGGS
VTYGVGSSDGNGYRKVLQDLLLANGYKVCMVGSRKAGLMHNNKNEGWRGYRLDQIESKAR
RSVASLKPNLFTINAGSNDCIQNHKLDAFGHRMDNLLEYLWETSPLSTVVLSTLLLNVDE
QVNSRVQDINSCLRDLVVLKEAEQKRIVLADMYSTKGPEVEDLMDGTHPKDDGYSKMAHI
WFEAIQKARANGFFHE

Enzyme Prediction     

No EC number prediction in FPRO_12584-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	52	245	1.5e-54	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.94e-38	52	245	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.37e-16	57	234	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.29e-13	57	244	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	1.48e-08	57	244	7	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.52e-08	54	241	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68641.1|CE3	6.82e-173	1	256	1	256
QKD62224.1|CE3	1.08e-122	55	254	1	200
QPG99528.1|CE3	8.69e-80	23	253	16	247
BCS23966.1|CE3	8.76e-80	36	252	48	266
QYT04935.1|CE3	2.32e-79	52	253	52	253

PDB Hits     

FPRO_12584-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	3.28e-16	11	246	2	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FPRO_12584-t41_1-p1.