CAZyme Information: FPRO_12553-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_12553-t41_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	FJOF01000015|CGC8	59930.16	8.0007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000015:709908-711602(+)

Full Sequence      

MLFSLVLPTLAFQASLALGDASVTVNTNKKLQVIDGFGVSEAYGHAKQFQNLGPGPQKQG
LDLLFNTTTGAGLSIIRNKIGCDASNSITSTNTDNPEKQPVFHFDGDDDGQVWFSKQAMS
YGVDTIYANAWSAPVYMKSATSMGRLCGTTGVSCSSGDWRQRYVEMIAQYLSYYKEAGIP
VSHVGFLNEGDGSDFMLSTAEQAADVIPLLHSALQSKGLADIKMTCCDNIGWRSQMDYTA
KLAELDVEKYLSVITSHEYSSSPDQPMNTTLPTWMSEGAANDQAFATAWYVNGGSNEGFT
WAVKIAQGIVNADLSAYIYWEGVETNNKGSLSHVVDTDGSKFTVSSILWAIAHWSRHIRP
GAHRLSTSGVVQDTIVGAFENVDGSVVMVLTNSGTAAQTVDLGVSGSTFATAQAFTSDAE
AQMVDTKVTVSDGNVKVTVPAHGVVTVKLTSAKSSKPVSTAVSLQSAPTPTSGKHSVVNQ
KHSSTTLSIVKAPTSTHTTSIVESAKAAKYPVPPVTTKGSAKSVPTKVAKKSATKKGSQR
SHSAHGASHHRCRHGSHRRGHCTK

Enzyme Prediction     

No EC number prediction in FPRO_12553-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	21	447	2.8e-168	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	1.82e-22	3	446	16	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	4.96e-11	54	356	20	293	Glycosyl hydrolase family 59.
405300	Glyco_hydr_30_2	1.51e-05	22	327	3	360	O-Glycosyl hydrolase family 30.
407314	Glyco_hydro_30C	8.55e-05	361	447	1	63	Glycosyl hydrolase family 30 beta sandwich domain.
407673	Melibiase_C	0.007	383	449	13	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73001.1|GH30_7	0.0	1	564	1	560
QGI85808.1|GH30_7	0.0	1	564	1	560
QGI99497.1|GH30_7	0.0	1	564	1	560
QGI68607.1|GH30_7	0.0	1	564	1	560
QKD62186.1|GH30_7	0.0	1	564	1	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	5.24e-108	11	450	14	454	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	9.03e-95	22	449	4	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.68e-93	22	449	11	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	5.86e-79	20	403	21	424	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.05e-76	20	403	92	495	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	1.24e-94	22	449	28	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|O16580|GLCM1_CAEEL	2.27e-08	19	399	83	488	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|O16581|GLCM2_CAEEL	1.58e-07	24	392	88	479	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999724	CS pos: 19-20. Pr: 0.7724

TMHMM  Annotations     

There is no transmembrane helices in FPRO_12553-t41_1-p1.