CAZyme Information: FPRO_12531-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_12531-t41_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: related to isoamyl alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1227		135442.14	6.4937

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000015:651103-654786(+)

Full Sequence      

MTWHAHLALVLGLVCLASAECTGMSDDCSANPIPLRQFNPLNYQAASCNLKWNNACFKIK
NGQKQQKPPPYLLCTSGHHPSGLLPVDAYTLAMQKGDSDSTKSAKYTLHGLWPSSSGGNG
AKDQPYGCLHGEEFDETILKTFRTLLNYFWPTDPKFGNTMQCFILSEWMKHGTCAVIPGA
DGNAFRLSQETYFRTAFVLANEFNANPDLRQQLDDPSSDDLESNVSAGCVQCAYLATVGW
EGTDVQSVPRMSGDCVDQCFSCGDSWDLCPPAQLDSTVQLDPSNAPVDSEANSDGMDNFA
VLDFAMPAFSKSNKISPWEGTWRSFGAEQGGSGKFQFAQTFTDKSLTVTTDSPYPQSCSY
ERRGSKELVLRCGGNRLEECLVQRLPDIGELEVAFLACNHTGQPAPASFYAAMDTPGCGN
FLMFRCKASAKGCSFSVDAKSASSKSDTKAESKSEPSPVSHSQPGIAGAPTSLLGFWRSL
QVSKHYEEGLANWSFTSDGQATLKWPNHPERGVESYSVSHSREDPNHVLLATASGAITTC
RFKFQYQPVHSFAVLDCTSGDKKTQWAMGRCNPCSAECRYSCSAENDNCGAGSCDLADSS
SAGALPPPKEHRWCTPEDSSCWPTKTAIKKLEKALDPSVPRLGVQWSNYPAPQPAPVPTG
SIDNQAFYGLGSTGLKALYYYENIDDMRRPCFNIQDGVSIWNTASEMCKAALHQNEYRNW
NPYIVVFPLNQRHITAALKFAAQHRLCIATAGTGHEYNSRNSCPTGGILIRTILLKNKEF
LPTWNEDPELAPAGAFRFGAGSIFAEMHAFSSKHDRVVASGWCSTVGMTGYHLGGGHGPF
APSMGLGVDNVLEIEVLQVGRNAHGQAVVHRKIVSRRKNPQLFWAMRGGGGGVWGIILSM
TLRAHAVPAGGLSRVFMSQTGTFCPGSKDKFGYEWLREMWPRFAEWQLRLNSKVSTQPGF
FIDTSKYKKGDLCTATWKFNFEYFYAGGQKEEEYVMFRDSLKDVLQTQTVQENNFNSAYD
YLLSMPPNKFQLSVMNPLPAPHEPSDDATGSQNSVFVSREDMETKFASTMMDVLDICVNS
LKTPDRTSPDPMGYRCGFHYLYTSITGNLGSAQPDDTAISPGFRSGLMLWNARTLSTKQC
EDTIYKLGRNSYFSESSYVMHNWTDRYWGEKRYEQLLAVKRAHDPGNLFWCHHCVGDDPD
DAYGNPLGVKKEKEKDIKVDPYKKDEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	712	909	2.3e-39	0.39082969432314413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.36e-13	722	857	1	129	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
238220	RNase_T2	3.06e-13	107	220	32	131	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen.
238512	RNase_T2_euk	5.06e-11	107	204	31	116	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen. Generally, RNases have two distinct binding sites: the primary site (B1 site) and the subsite (B2 site), for nucleotides located at the 5'- and 3'- terminal ends of the sessil bond, respectively. This CD includes the eukaryotic RNase T2 family members.
395357	Ribonuclease_T2	8.62e-11	100	204	25	117	Ribonuclease T2 family.
223354	GlcD	4.33e-09	722	908	32	207	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	3.95e-17	722	908	598	775
QKD57322.1|CBM91|GH43_11	3.95e-17	722	908	598	775
UNI23960.1|AA7	1.77e-09	722	947	48	244
EGX49222.1|AA7|CBM1	2.29e-09	720	908	162	334
UQC87672.1|AA7	5.73e-09	691	909	39	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	7.92e-22	722	1198	124	561	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO4_A	1.01e-13	705	965	31	262	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	1.01e-13	705	965	31	262	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
4UD8_A	1.47e-12	719	909	79	256	AtBBE15 [Arabidopsis thaliana],4UD8_B AtBBE15 [Arabidopsis thaliana]
6FYE_A	8.43e-12	697	907	20	211	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B1Z7|A2478_ARTBC	1.40e-24	722	1198	122	560	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02478 PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	1.31e-22	614	905	29	291	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|L0E2Q5|PHQH_PENFE	6.52e-22	713	905	114	299	FAD-linked oxidoreductase phqH OS=Penicillium fellutanum OX=70095 GN=phqH PE=3 SV=1
sp|E1ACP9|NOTD_ASPSM	9.33e-22	737	1204	144	585	FAD-linked oxidoreductase notD OS=Aspergillus sp. (strain MF297-2) OX=877550 GN=notD PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	4.08e-21	722	1198	124	561	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000190	0.999788	CS pos: 19-20. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in FPRO_12531-t41_1-p1.