CAZyme Information: FPRO_11518-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_11518-t41_1-p1
• CAZy Family: GH33
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		34903.51	4.1066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000010:306431-307378(+)

Full Sequence      

MRQSTLYPFLCLWGLAESIDLSSKRGLAYHGDDHKSDNELLISNNSEIAWYYTWSLWPNG
QIGSSLPFVPLIHGLDDASDSELESRLNGLPESSTHLLTFNEPDGETDTGGSAISAKDAA
RAYIEHIVPLRKAKRKWSISHPSVTGSPRGLEWLRDFNESCYDIDDDGCPTDFVAVHWYG
DAGGLKNWLGSLREFYNETAPDARFWITEMALPKEDDDATLAMMNESLPYLDNNDDVQAY
AWFGAFRKDDANEWTGDSVSLFDDDGGLTKLGAEYLGGEEKGFEEGMSGDSGGSFHAPSL
GIMLAMTLVSLFPLW

Enzyme Prediction     

No EC number prediction in FPRO_11518-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	43	275	3.7e-51	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	3.11e-60	36	275	6	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT72013.1|GH128	5.53e-238	1	315	1	315
QGI84896.1|GH128	3.20e-237	1	314	1	314
QGI67667.1|GH128	3.20e-237	1	314	1	314
QGI98551.1|GH128	3.20e-237	1	314	1	314
QKD48718.1|GH128	1.70e-229	1	315	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	5.20e-22	22	243	2	209	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	9.49e-22	22	243	33	240	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]

Swiss-Prot Hits     

FPRO_11518-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000342	0.999635	CS pos: 18-19. Pr: 0.9630

TMHMM  Annotations     

There is no transmembrane helices in FPRO_11518-t41_1-p1.