CAZyme Information: FPRO_11235-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_11235-t41_1-p1
• CAZy Family: GH30
• CAZyme Description: probable acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	FJOF01000005|CGC2	33839.99	8.7280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000005:2963248-2964281(+)

Full Sequence      

MQLTSIISFWALALFSLVLAAEPVPRGQLTQVNSYGNNPTGTKMSLYVPKNLKSNPAVVV
ALHYCGGTSQAYYQGTKWASNAEKYGFIVIYPQTPYSGGCWDVSSKMTLTHEGGGCSTSI
ANMAKYVLKQYNGDAKKVFVTGESSGAMMTNVMLATYPDVFAAGSAYAGVPAGCFVSQAN
QAAAWNSTCSQGKSIYTQTQWANVVKNMYPGYNGARPKFQIYHGTADPTLNVQNYYEEIK
QWTGIFGYSSNPQSSTPNTPASPYTRQVFGEKFQAFLGQGIGHGNPHFDDNDLKWFGFIV
SHVQNPSEARN

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	233	5.8e-23	0.7665198237885462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	2.13e-44	44	256	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	3.06e-24	11	286	11	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.71e-22	45	234	4	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226584	COG4099	1.46e-07	43	242	175	381	Predicted peptidase [General function prediction only].
224423	DAP2	3.11e-07	49	170	388	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI84699.1|CE1	2.73e-236	1	311	1	311
QGI67473.1|CE1	2.73e-236	1	311	1	311
CCT71718.1|CE1	7.83e-236	1	311	1	311
QGI98355.1|CE1	4.53e-235	1	311	1	311
QKD58910.1|CE1	1.95e-206	1	299	1	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	6.22e-114	27	298	2	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B037|AXE1_EMENI	6.74e-122	22	298	26	302	Acetylxylan esterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=axeA PE=1 SV=2
sp|B8NBI2|AXE1_ASPFN	8.63e-121	24	298	29	305	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	4.95e-120	24	298	29	305	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|A9JPE6|AXE1_ASPFL	4.95e-120	24	298	29	305	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1
sp|Q4WBW4|AXE1_ASPFU	2.44e-118	21	298	26	304	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999793	CS pos: 20-21. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in FPRO_11235-t41_1-p1.