CAZyme Information: FPRO_10563-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_10563-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: related to acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		33743.13	6.6883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000005:890187-891156(+)

Full Sequence      

MHLFQNLSLLLLPAAALAGVIPYEIRKGFANPKTGPHSKKSTDIHAQEENDFLSFKGTPP
GKAVQGGVKLRILSVGDSITVGFGKGTDGNGYRKRLGKNLSSKMAPSSSWNLTDIVSGNE
VVWAGTEKTTGDMKDGHFAAWSGKTVQYINDHIDPSLEQRPNLILIHAGTNDMNSNRHIS
TDGNIPQDTTNRLRSLVEKMMSKCPDATIIIGMITDVCDNEWYHFQREGIKIYRQHIAEL
AAELRANGSHVLAADFGPFDDTLLSDCVHPTQKGYEILGHWWYDYIHQIPEGWIKDPVGL
DPVRD

Enzyme Prediction     

No EC number prediction in FPRO_10563-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	70	286	9.2e-40	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.82e-36	135	286	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.07e-24	75	277	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.50e-14	72	285	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239945	SGNH_hydrolase_like_4	1.56e-10	71	279	2	176	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.61e-10	72	282	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71135.1|CE0	1.28e-222	1	305	1	305
QGI66858.1|CE0	1.28e-222	1	305	1	305
CEF83009.1|CE0	3.08e-80	50	302	28	262
QPC73171.1|CE0	1.70e-79	50	302	28	262
QYS93131.1|CE0	6.66e-75	53	305	32	268

PDB Hits     

FPRO_10563-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRO_10563-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003199	0.996768	CS pos: 18-19. Pr: 0.9637

TMHMM  Annotations     

There is no transmembrane helices in FPRO_10563-t41_1-p1.