CAZyme Information: FPRO_10454-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_10454-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: related to beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	FJOF01000005|CGC5	43871.86	8.3152

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000005:613615-614739(+)

Full Sequence      

MIPKAVFRGILVIGICSLLWLTFRPFRGSRAVFTKSLQSIDLLSPTPHHDRKTSELYASR
AAHDLCSVHGYSAFVPKSPSSERKVYDMLMINDELDFLEIRLDALYDYVDYFIIVESAKS
FQANSKPLILKENWDRFRRYHHKIIYHKLVFPSSFDPHRAWDYEDLQRDAPFDQVLLSLE
GPRAPNKGDVLIVADVDEIPRPQTLLVLQYCDFPRRLTLSSKFYYYSFQFLHTGPEWQHP
QATYYQGHRTLKPTNLRNGDGGFRPFRFLERDVLTNAGWHCSSCFPTIDQFLNKMASFSH
RWMNREEYRDRDKIAAAVREGKDLWGREQDQFVRIEDNKDMPSLVLNEPNRFGYMISRDG
PSAGFVDYNRKEKS

Enzyme Prediction     

No EC number prediction in FPRO_10454-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	63	355	2.3e-79	0.9788732394366197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	2.04e-49	61	326	56	300	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71044.1|GT17	1.23e-273	1	373	1	373
QGI83999.1|GT17	1.23e-273	1	373	1	373
QGI66762.1|GT17	1.23e-273	1	373	1	373
QGI97648.1|GT17	1.23e-273	1	373	1	373
QKD58150.1|GT17	4.82e-256	1	373	1	373

PDB Hits     

FPRO_10454-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRO_10454-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999914	0.000128

TMHMM  Annotations     

Start	End
5	23