CAZyme Information: FPRO_10284-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_10284-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825		91275.97	5.6335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000005:200831-203426(+)

Full Sequence      

MDFQSLLPELTLEEKVSLLSGRDFHAAAGIDRLGIPPMKVANSVNGIGPHDMELEVTTAS
FPSTTCYGSTFDAELLGRLGEELAVQARLKSAQLVLGPTINIHRDPRGGRNFECFSEDPL
VSGQLAGAIVNGLHRGGLGVCVKHFVCNDAETHRHSYNVRESIDGRTLREIYLAAWQHLL
RTSDPEGVMTAYNKIDGQFCSANRDLIERVLRRDWAFKGMTMSDWFGVHDTVGPIKAGLD
LEMPFPVFRASKLVEAVHSGAVTEEEINNRVKMMLELRNRTRSCHDQKPERSEIRDEANK
LAWEIATSGIVLLKNANKTLPLSPADCPKIALIGEFAADPVVTGGGSASCIPQYRFSPLD
IMRQEFPSVKCALGVRTRRLIPIAPTEQLISADGRPGVDIEYYDEESSELLLSEFQARPH
VWMLGRFKPGLRVPGCNLQLTTKLIPVSTGRHTLAVRCTGSFSLAINDKIVLTGPGKDIS
TEQFIFNPILLESRLQAFMEAGKSYDIHVIVKGPEELAVGEPTPFSATLCFEEYRSEEEA
IAEAAKLASESDISIIYAGRSDQYESEGFDLEDMHMPLNQTALIKAVAAVSKKTVLVLHC
GNPIDVSPFVDDVDVILNAHFPGQEGARAVTDLFTGKVCPSGRLATTWFKTLEDCPSFEH
FSPKGVEEGSIYLEYKEGLEVGYRCRDSQSRVRWPFGFGLSYTTFSYSGLRATVDEQSTV
SKLKCHVEVKNTGAVSGKEVIHLYIKPAKDTSVWRPERELKAFTKVSLQSGVSQLVKLEV
DLDVACSYWDENEVAWRMQPGIYKACIADQQVDFTVHKGSVWNHL

Enzyme Prediction     

No EC number prediction in FPRO_10284-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	244	7.5e-56	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.03e-55	22	352	47	376	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.60e-52	61	807	120	750	beta-glucosidase BglX.
178629	PLN03080	5.62e-47	4	816	54	777	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.38e-39	546	702	86	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	7.63e-33	32	277	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI65540.1|GH3	0.0	2	825	10	835
UQC84261.1|GH3	0.0	2	811	872	1678
QKD60029.1|GH3	1.32e-308	1	816	1	820
CCT73941.1|GH3	2.07e-300	1	816	1	811
QGI86914.1|GH3	2.07e-300	1	816	1	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.07e-129	2	825	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.03e-124	2	825	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.76e-110	1	816	3	662	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.64e-101	9	803	11	644	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.47e-87	6	804	7	695	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.01e-134	4	815	12	831	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.71e-131	6	825	5	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.27e-128	1	822	4	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.27e-128	1	822	4	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	4.91e-128	1	822	4	835	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.948723	0.051304

TMHMM  Annotations     

There is no transmembrane helices in FPRO_10284-t41_1-p1.