CAZyme Information: FPRO_09593-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_09593-t41_1-p1
• CAZy Family: GH2
• CAZyme Description: related to beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
986		107302.36	7.1382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000006:1605449-1608819(-)

Full Sequence      

MAPPPAGSASSSSSREGYRSVNASHRYLKHAGPSRGEPESQQKRSKYHVTRHRRLPTIMA
HTDNSDLDPAWQDLDRAIGQILIMGWDGTEVTPQIRSLIEDHHLGSIILTAKNLKSAQQT
AELVQELQTIAKNAGHLQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRADLAYE
VTKATATEISACGVNLMLGPVLDVLNNARYQPLGVRATGDDPQEVSQYGLAALRGIRDAG
IASCGKHFPSYGNLNFLGSNLDVPIITQTLEELSISALVPFRNAVASGKLDAMFIGGCGI
SNPSMNVSHACLSDQVVDELLRDELGFNGVAISECLEMEALSHELGVQNGVIMAVEAGCD
LVLLCRAYDVQLEAIKGLKLGYDNGIVTKERIFTSLRRVLNLKSTCTSWEKALNPPGISL
LSQLHPSHLALSLQAYDDSITIIRDKEKLIPLTASMHPGEELLLLTPLVKPLPASSLTKK
LLAAKDSQNQAEGQHEMWAHNGRDRSAILSGEGVFREFGKSLARARNEKLLHTSYTANGV
RPVHENLIHRASCIIIVTADANRNLYQAGFTKHVDMMCSMLRTRGQKKQLIVVAVSSPYD
FAMDKSIGTYLCTFDFTENALHALARTLVGEIAPLGTLPGTLRKSKKVLKSRQHWLVEEY
SSKRDASALNDLLRAVHRASAPDLQFLRTTTAASFQLNNANISESHFVVRNSSTNALYGF
AATYFVHGVGILGGVFVEPTKRDVSIGRSLHRRALRSLMQRRGIKQVQIGSAFPGVFLGI
PNDVEVNTIKEWFANSGWDVQFPRRVSNMILQDVASWSAPEGLSQSIQRAGISFDLIHDL
DNADGVLGHVRNNANPEVLELYRHALSESKLSGIVRAKDATGALLGTIIVCKQRSPLETH
IPSLVSRSEDIGGIIAPVVPPGPQTTLALQGLTLMGIRQARSHKATKVVLGWVVDDGTES
LTAMGFETLQEFEEITNSPENFSNII

Enzyme Prediction     

No EC number prediction in FPRO_09593-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	139	363	5.5e-48	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.91e-67	78	458	7	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.06e-57	74	402	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	5.68e-35	88	379	10	294	beta-hexosaminidase; Provisional
178629	PLN03080	1.40e-06	163	455	114	418	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT70761.1|GH3	0.0	1	986	1	986
QGI66013.1|GH3	0.0	1	981	1	981
QGI83252.1|GH3	0.0	1	981	1	977
QKD56115.1|GH3	0.0	1	986	1	985
QGI96895.1|GH3	0.0	1	981	1	970

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.07e-92	73	890	8	769	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.42e-65	74	642	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.17e-39	74	639	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.58e-39	74	639	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.22e-39	74	639	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	6.01e-39	74	639	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.30e-33	82	382	6	300	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	4.02e-32	81	381	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	7.37e-32	81	381	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|Q0A911|NAGZ_ALKEH	6.65e-30	82	366	6	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRO_09593-t41_1-p1.