CAZyme Information: FPRO_08980-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_08980-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: related to cell wall glycosyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		44111.73	5.0573

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000016:312999-314190(-)

Full Sequence      

MKFQTLLTVASANLVLANNLLATTADSWIRNNRETQRAYWYGRAVVYEGIEATIELTKNK
TLLAWYRDQMDDVVYPNGTIINYDLTKYSLDNYRIGLNLLYWYKQTGEEKYKVAADFIRD
RINQHPRTPTGGFWHRSPTYPDQMWLDGIFMCDSFYAEWTAEFDAKNTTAWDDIVLQWDK
IQEVTIDKETGLPVHGFDESKTAVWADPETGASPIVWSRAVGWYIWSLIEVLDVFPKSHP
GYKRLVTYYKDLSSALLRAQGPESHLWELVMNKEYEGVEGNYIESSASAMFTYGWLAGLR
RGLLDEKTYTKPAKQAYKRLIRDFVTKNNNGTITWEGTVEVGSLNSDASFEYYTEVPVVP
NDTRGMGPFMMAIYEWERRSK

Enzyme Prediction     

No EC number prediction in FPRO_08980-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	378	1.2e-100	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.14e-65	21	378	16	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	4.16e-62	41	379	29	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69602.1|GH105	3.23e-293	1	381	1	381
QGI65428.1|GH105	3.23e-293	1	381	1	381
QGI96309.1|GH105	3.23e-293	1	381	1	381
QGI82677.1|GH105	2.66e-292	1	381	1	381
QKD55506.1|GH105	7.01e-288	1	381	1	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.62e-78	25	377	9	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.16e-49	16	377	20	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.34e-48	16	377	10	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	2.45e-07	105	320	105	307	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3QWT_A	3.38e-06	97	322	116	330	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.62e-48	16	377	20	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.73e-28	191	375	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.73e-28	191	375	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001159	0.998816	CS pos: 22-23. Pr: 0.9086

TMHMM  Annotations     

There is no transmembrane helices in FPRO_08980-t41_1-p1.