CAZyme Information: FPRO_08797-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_08797-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: probable cellobiose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		90174.02	6.3244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000016:731560-734459(+)

Full Sequence      

MVSYRSLWLLALTPFTQYVSAQQSTPVSYTDPDTGIVFDTWTASGSRMTFGFAFPEDGQT
TNADELIGYLNCATPSGKGIGWCGLSYGGPMTNSLLLMAYPHDGDILTSFFWANAQVEPV
QYKGKASLTQISSSITADGFTLIYRCQGCTSWSQDGNSGQLATTSSIAVLGWAHSTTDVI
DPECPREARMLQHETQSIFGGQLTSNAFNSKYGTWAKLATKVVEGNCGGEQPTSTATSQP
SSTAAPSSTPVPDETYDYVVVGGGAGGLPVADRLSEAGKKVLLIEKGPPSSGRWGGTRKP
DWLGGTNLTRFDVPGLCNEIWADSSGIACPDTDQMAGCVLGGGTAINAGLWWRPNPTDWD
FNFPDGWKAKDMATYEQRVFGRIPGTRYPSMDGKLYLDQGFKVVAGALDKAGWNEVNALE
KPGAKNRTYTHPPFMFSGGERGGPLATYLVSAKARNNFKYWTNTQVRRVVRSGGHVTGLE
VEPFSGAGYVGTVKLTPETGRVILAAGTFGSAKILLRSGIGPDDQLSVVANSSRDGGSMI
TKDQWINLPVGYNLEDHTNTDTVIKHPSVVFYDFYEAYDNPIPSDKNKYLDARSGILAQA
APNIGPIIFDEISGADGRVRSMQWTARVEPSLGETSNKSITISQYLGRGAKSRGRMTITS
ALNTVVSGNPYLNDAEDKKAVVKALDNLRKALSGVEGLEWLQPAPGVTSQKYVDDMVVSW
SNRRANHWIGTNKLGKDDGRQGGTAVVDLNTKVYGTDNLFVTDASIFPGMVTTNPSAYIV
TVAERASAAILALPVSKAQGQYQQCGGNEWTGNMQCGKGFYCKILNPFYSQCYPDSNR

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	243	793	2e-255	0.9908759124087592
AA8	29	215	7e-60	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	4.14e-64	29	211	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	5.50e-44	252	792	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	5.59e-39	28	203	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
235000	PRK02106	4.74e-26	271	798	21	542	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.08e-25	651	786	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69443.1|AA3_1|AA8|CBM1	0.0	1	838	1	856
QGI82521.1|AA3_1|AA8|CBM1	0.0	1	838	1	856
QGI96154.1|AA3_1|AA8|CBM1	0.0	1	838	1	856
QGI65272.1|AA3_1|AA8|CBM1	0.0	1	838	1	856
QKD55357.1|AA3_1|AA8|CBM1	0.0	1	836	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	0.0	26	832	4	805	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	0.0	26	832	5	806	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI4_A	1.52e-276	250	832	1	584	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	4.22e-124	256	793	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	4.92e-124	256	793	8	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	6.77e-157	9	793	6	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.34e-22	256	787	5	524	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q1MJU4|BETA_RHIL3	1.41e-20	257	791	4	526	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=betA PE=3 SV=1
sp|A8JHB7|FAP_CHLRE	2.41e-20	250	788	40	594	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|E4QP00|HMFO_METS6	3.00e-20	253	791	3	528	5-(hydroxymethyl)furfural oxidase OS=Methylovorus sp. (strain MP688) OX=887061 GN=MPQ_0130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000418	0.999545	CS pos: 21-22. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in FPRO_08797-t41_1-p1.