CAZyme Information: FPRO_08625-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_08625-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: related to spore coat protein SP96 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	FJOF01000011|CGC8	43046.08	4.4501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000011:1314416-1315663(-)

Full Sequence      

MPSLLSTLSILALTATQVSSHVIMVEPHPFNLDTEPLYQTWPLSEDLPFPCQGRTQHPEQ
VTKVTAGTTQLVKFWGSAVHGGGSCQFSVAYGKEPPKDPKKWHTIYSIIGGCPAEAEGNI
ASTGTDPHGRENGKECGNNTGKECTKQFNIPIPKDMQNGPATFAWTWFNKIGNREMYMVC
SPIEVVGGKDDSSYVDTLPAIFRANIPGECTTGASGSVINFPEPGDFGKIYEQGTPGSEG
TCAKGVEPNFKDDTAAPGPEKPAESGSPAPAQPSAPAPAPEQPSAPVEGAPAAPSAPVQP
SVPAPAPEQPSAPVPAPEQPSAPAQPSAPASPSSMVTMPSTPAQPTDSPAPIDSAKPEAG
APAWSGEFQACPSDVKSGMMHCFSETSWGICNGGWAFVSKVAEGTKCIDGAIAAE

Enzyme Prediction     

No EC number prediction in FPRO_08625-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	227	1.4e-63	0.9476439790575916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411490	pneumo_PspA	2.67e-08	253	395	348	472	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
237865	PRK14951	1.02e-07	290	372	374	457	DNA polymerase III subunits gamma and tau; Provisional
237865	PRK14951	4.92e-07	255	370	387	503	DNA polymerase III subunits gamma and tau; Provisional
411474	fibronec_FbpA	5.08e-07	255	365	183	305	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
237865	PRK14951	6.46e-07	289	363	369	437	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55128.1|AA11	4.43e-233	1	415	1	360
CCT69101.1|AA11	6.69e-233	1	415	1	409
QGI65138.1|AA11	5.01e-226	1	415	1	401
QGI96022.1|AA11	5.01e-226	1	415	1	401
QGI82391.1|AA11	5.01e-226	1	415	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	1.31e-35	21	227	1	198	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

FPRO_08625-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999729	CS pos: 20-21. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in FPRO_08625-t41_1-p1.