CAZyme Information: FPRO_08541-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_08541-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832		90907.99	4.9488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000011:1080217-1082763(+)

Full Sequence      

MADINVEEVLKKLSLAEKVSLLAGIDFWHTKSLPEHGVPSLRLSDGPNGVRGTRFFNGIP
AACFPCGTGLGATFNQELLEEAGRKMGEEAIGKSAHVILGPTINMQRSPLGGRGFESIGE
DPFLAGLGAAALVRGIQSTGVQSTIKHFVCNDQEHKRMSVQAIITERALREIYALPFQLV
VRDSQPGAFMTSYNGVNGTACSENKKLLNDMLREEWGWEGLIMSDWYGTYSVTDAIKAGL
DLEMPGPTRWRGDVLNFAAACEKVWGHVIDDRAREVLKFVKKCAASGVEENGPEKTLDTP
ETAALLRKIGNESIVLLKNEKSLLPLAKDKKTLVIGPNAKVATYHGGGSASLAAYYAVTP
YDGIAEKLGSQPAYTIGAYTHKLSPLLGSQTKGEDGKAGMSWKVYNKPPSDSSRKPVDEL
WLAKSEMHLVDYYNSELEDLWFANLEGILEVEEDSTYEFGVIVCGTANLYVNDELVVDNS
TKQIAGDAFFGTATREELGCKDLKKGEKYKVRIEFASAPSFTLKLDNPVVGHGSLRVGAS
KVIDAKQEIERSVALAKKHDQVIICAGLNSDWETEGSDRESMKLPGALDELISAVAAANP
QTTVVMQTGTPEEMPWLDEVPAVIQAWYGGNETGNCIADILFGDANPSGKLSLSFPKRLT
DVPAFLNFRTEAGRTLYGEDVYMGYRYYEFANREVNFPFGHGLSYTTFAFSDLNISSKEG
KLTTSVTIKNTGSIRGAEVAQLYVRPMQAAKVNRPVKELKGFTKVELDAGESKTVNITEL
EKYAAAYFDEEKDKWCVEAGEYEVIISDSSAVTDKALKGSFKVDETYWWSGI

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	245	3.8e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.29e-84	64	821	120	762	beta-glucosidase BglX.
224389	BglX	9.59e-69	37	372	59	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.64e-56	314	705	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.10e-47	13	778	60	741	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.12e-36	51	277	78	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI95949.1|GH3	0.0	1	832	1	832
QGI65065.1|GH3	0.0	1	832	1	832
CCT69025.1|GH3	0.0	1	832	1	832
QGI82319.1|GH3	0.0	1	832	1	832
QKD55051.1|GH3	0.0	1	832	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.74e-282	1	832	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.22e-275	5	832	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.91e-133	4	826	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.53e-120	5	830	4	676	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.69e-102	5	825	3	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	1	832	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	832	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	1	832	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	1	832	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DFA8|BGLI_NEOFI	2.42e-318	1	832	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000055

TMHMM  Annotations     

There is no transmembrane helices in FPRO_08541-t41_1-p1.